KEGG   Klebsiella oxytoca CAV1374: AB185_09155Help
Entry
AB185_09155       CDS       T04534                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
koc  Klebsiella oxytoca CAV1374
Pathway
koc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
koc01100  Metabolic pathways
koc01110  Biosynthesis of secondary metabolites
koc01130  Biosynthesis of antibiotics
koc01230  Biosynthesis of amino acids
Module
koc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:koc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AB185_09155 (aroK)
Enzymes [BR:koc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AB185_09155 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA_16 AAA AAA_22 TsaE ABC_tran APS_kinase AAA_7 AAA_5 AAA_17 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_2 AAA_28 AAA_25 AAA_29 RsgA_GTPase His_biosynth PduV-EutP AAA_24 Mg_chelatase MMR_HSR1 IstB_IS21 GTP_EFTU AAA_14
Motif
Other DBs
NCBI-ProteinID: AKL34055
UniProt: A0A0G3R8Q1
LinkDB All DBs
Position
856435..856956
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEDGFR
DREEKIINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDAPPREVLEALADERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
gggcgccagttagcccaacagctcaacatggaattttacgattccgatcaagaaattgag
aaacgcactggcgcagatgtgggttgggtctttgatgtagaaggcgaagacggcttccgc
gaccgtgaagaaaaaatcatcaatgagttgacggaaaaacagggaatcgtgctggcaacc
ggcggtggctctgtaaaatcccgtgaaacgcgtaaccgtctctccgcccgcggcgtggtg
gtctacctggaaacaactatcgaaaagcagcttgcccgtacgcagcgcgataaaaagcgt
cctttgctgcaggttgatgctccgcctcgcgaagtactggaagcgctggcggatgaacgc
aatccgctgtacgaagagattgcagatgtcactatccgcactgacgatcaaagcgcgaaa
gtggtagcaaaccagattattcatatgctggaaagcaactga

DBGET integrated database retrieval system