KEGG   Klebsiella oxytoca CAV1374: AB185_16330Help
Entry
AB185_16330       CDS       T04534                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
koc  Klebsiella oxytoca CAV1374
Pathway
koc00010  Glycolysis / Gluconeogenesis
koc00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:koc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB185_16330
   00500 Starch and sucrose metabolism
    AB185_16330
Enzymes [BR:koc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     AB185_16330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038 Albumin_I_a
Motif
Other DBs
NCBI-ProteinID: AKL35370
UniProt: A0A0G3S6H6
LinkDB All DBs
Position
2332950..2334344
Genome map
AA seq 464 aa AA seqDB search
MKTFPQAFLWGGATAANQVEGAYLEDGKGLTTSDVQPRGVFGDVVERVPGDSGIKDVAID
FYHRYPEDISLFAEMGFNCLRVSIAWARIFPEGDEAQPNEAGLAFYDKLFDEMAKHNITP
LVTLSHYEMPWALVKNYGGWGNRKVIGFFERYARTVFARYQAKVKLWLTFNEINMSLHAP
MTGVGLPADSSKAEVYQAIHHQLVASALAAKACHDIVPEGKIGNMLLGGLMYPLSCKPDD
IFETLQQNRSWQFFGDVQCRGAYPGYMLRYFRDNGISLEITDADREALKETVDFISFSYY
MTGCVTADEELNKKSRGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDRVEADGSINDDYRISYLNDHLVQAREAIEDGVELMGYTSWGPIDLVSASKAE
MSKRYGFIYVDRDDEGNGTLARSRKKSFWWYKEVIATNGGSLKE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattcccacaggcgtttttatggggcggcgcgaccgcggcaaaccaggttgaa
ggcgcttatctggaagacgggaagggattaaccacttctgacgtccagccgcgcggcgta
tttggcgacgtcgtagaacgcgtgcctggcgatagcggtataaaagatgttgccatcgat
ttttaccatcgttatccggaggatatcagcctctttgccgagatgggctttaactgcctg
cgcgtatccattgcctgggcgcgtattttccctgagggcgatgaggcgcagccaaacgaa
gccgggctggccttttacgataagctgtttgatgaaatggcgaagcacaatattactccg
ctggtgaccctgtcccactatgagatgccgtgggcgctggtgaaaaactacggcggctgg
ggcaatcgcaaagtcattggcttcttcgaacgctacgcccgtacggtgtttgcgcgctac
caggcgaaggtcaaactgtggctgacctttaatgaaatcaatatgtccctgcacgcgccg
atgaccggcgtcggtctgccggccgacagcagcaaagctgaagtctaccaggctattcat
catcagctggtggcgagcgcgctggcggctaaggcctgccatgacatcgtgcctgagggc
aaaatcggcaacatgctgctcggcggcctgatgtatccgctgagctgcaaaccggacgat
atttttgaaactctgcagcagaaccgcagctggcagttctttggcgatgtccagtgccgc
ggcgcttatccgggctatatgctgcgctatttccgcgacaacggcattagccttgagatc
accgatgccgatcgcgaagccctgaaagagaccgtcgattttatctccttcagctactat
atgaccggctgcgtgaccgccgacgaagagctgaacaaaaaatcgcgcggcaatattctc
agcatggtgccgaacccgcacctggcaagctcggagtggggctggcagattgaccccctt
ggcctgcgcacgctgctgaacgtgctgtgggatcgctatcagaagccgctgtttatcgtg
gagaacggcctgggcgctaaggatagggtggaagctgacggtagcattaacgacgattac
cggatcagctaccttaacgaccatctggtgcaggctcgtgaggcaatagaggacggcgtt
gagctgatgggctacaccagctgggggcctatcgacctggtgagcgcgtcgaaggcggag
atgtccaaacgctatggctttatctacgtcgatcgcgacgatgaaggcaacggcaccctg
gcgcgcagccgcaagaagagcttctggtggtataaagaggtaatcgccaccaacggcggc
agcttaaaagagtaa

DBGET integrated database retrieval system