KEGG   Klebsiella oxytoca CAV1374: AB185_17495Help
Entry
AB185_17495       CDS       T04534                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
koc  Klebsiella oxytoca CAV1374
Pathway
koc00500  Starch and sucrose metabolism
koc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AB185_17495
Enzymes [BR:koc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AB185_17495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C Malt_amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: AKL35574
UniProt: A0A0G3S5N2
LinkDB All DBs
Position
complement(2591322..2592809)
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPTGGELWREVEALAPNLNEIGINMIWLPPAYKGASGGYSVGYDCYD
LFDLGEFDQKGSVATKYGDKAQLLAAISALRQHDIAVLLDVVVNHKMGADEKEPVRIQRV
DQNDRTQIAEEIVECEAWTRYTFPVRAGKYSEFIWDYKCFSGIDHIENPDEDGVFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNRAVTEEIKYWARWVMEQTGCDGFRLDAVKHI
PAWFYKEWIDHVQEVATKPLFIVAEYWSHEVDKLQQYIDMVDGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFSGTLVEADPFHAVTLVTNHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYADLFGASYEDTGGDGETYAVEMPVIEQLHELIDARQRFAHGVQTLWFDHPNCI
AFSRSGTEEDPGCVVVLSNGDDGEKTLPLGENYRNKRWRDFLGNREEVIETDDEGNGVFT
CNGGSVSVWVIEEAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccacgttactgcagtgctttcactggtactaccccaccggcggcgagtta
tggcgtgaagtcgaagccctggcgccaaacctcaacgaaatcggcattaacatgatttgg
ttgcctcctgcctacaaaggcgcctccggcggctactctgtcggttatgattgctacgat
ctgtttgacctcggcgaattcgaccagaaggggtctgtcgccacaaaatatggcgataaa
gcccagctgctggccgccatatccgccctgcgccagcacgatatcgccgtactccttgac
gtcgtggtcaaccataaaatgggcgcggatgaaaaagagccggtacgtattcagcgtgtt
gatcaaaacgaccgcacgcaaatcgccgaggagattgtggaatgtgaagcctggacgcgc
tacaccttcccggtacgcgccgggaaatactctgaattcatctgggattataagtgcttc
agcggcatcgaccatattgagaatcctgatgaagatggcgtgtttaaaatcgtcaacgac
tataccggagagggatggaacgatcaggttgatgatgaaatgggtaacttcgactacctg
atgggtgaaaatatcgattttcgcaatcgggcggtaaccgaggagattaagtactgggcc
cgctgggtgatggaacagaccggctgcgatggcttccgcctcgatgcggttaaacatatc
cccgcctggttttataaagagtggattgaccacgtccaggaggtggcgacaaagccgctg
tttatcgtggcggaatactggtcgcatgaagtcgataagctccagcagtatatcgacatg
gttgacggtaagacgatgctctttgacgcgccgctgcagatgaaattccatgaagcctcg
cggcagggacgcgactatgacatgagccagatttttagcggcaccctggtggaagccgac
ccgttccacgccgtaaccctggtgaccaaccatgatacccagccgctgcaggcgctggaa
gcgccggttgaggcctggttcaaaccgctggcttatgcgctcattttgttacgtgaaaac
ggcgttccgtccgtcttttatgccgacctgttcggcgccagctacgaagataccggcggc
gacggcgagacctacgccgttgagatgccggttattgagcaattacacgaactgatcgat
gcccgtcagcgttttgctcacggcgtacaaactttgtggttcgatcatccgaactgtatc
gctttcagccgcagcggtaccgaagaggatccgggctgcgtggtggtgctttccaacggt
gacgacggagaaaaaacgcttcctctgggggaaaactaccgtaataaacgctggcgtgat
tttctcggcaaccgcgaggaagtgattgaaaccgacgatgaaggaaacggggtttttacc
tgtaacggcggcagcgtcagcgtctgggttatcgaagaggcgctataa

DBGET integrated database retrieval system