KEGG   Klebsiella oxytoca CAV1374: AB185_27700Help
Entry
AB185_27700       CDS       T04534                                 

Definition
(GenBank) iditol 2-dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
koc  Klebsiella oxytoca CAV1374
Brite
KEGG Orthology (KO) [BR:koc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AB185_27700
Enzymes [BR:koc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     AB185_27700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AKL37451
UniProt: A0A0G3SAZ4
LinkDB All DBs
Position
complement(4751184..4752257)
Genome map
AA seq 357 aa AA seqDB search
MEQLPEDMKAVVCHGPQDYRFEKIPRPVAKEKEVVIKVDGCGICAGDCKAQDGAPMFWGD
NPWVKTPVVPGHEFYGRVAELGPGSAEKYQLKIGDRILAEQIVPCHECRFCKTGKYWMCE
THDIYGFQKDVADGGMAEYMRFSERAIIHKIPESLSEEDAALIEPMACAIHTVRRGDIEL
DDVVVIAGAGPLGLCMVQVAHLKTPKKLVVIDTMDDRLALAKAFGADVVINAAQEDAIAI
VKSMTDGYGCDVYIEATGAPIGVTQGLEMIRKLGRFVEFSVFGKETTADWSIIGDRKELD
IRGAHLGPYSYEIAIDLFARGLLTAKGVVTHFYSIDEWKAAFEMAKSLDSIKVVIKP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaacaattacctgaagatatgaaagcggttgtctgccatggtccccaggattatcgc
tttgagaaaattccccgcccggtcgccaaagaaaaggaagtggtcattaaggttgacggg
tgtggaatctgcgccggcgactgcaaggcccaggacggcgcgccgatgttctggggcgat
aatccgtgggtgaaaacgccggtggtgcccggccatgagttttacggtcgggttgccgaa
ttaggcccgggctccgctgaaaaatatcaattaaaaattggcgatcgcatcctggctgaa
cagattgtcccctgccatgagtgccgtttctgtaaaaccggcaaatactggatgtgcgaa
acccatgatatttacggtttccagaaggatgtcgccgatggcggtatggctgaatatatg
cgtttttccgaacgggcaattattcacaaaattcctgaatcattaagtgaagaagatgcc
gcgctgatcgaacctatggcctgcgcaatccacacggtacgccgcggtgatatcgaactg
gatgatgtggtcgttatcgccggcgccgggccgctggggctgtgtatggtgcaggtcgct
catctgaaaacgccgaagaaactggtggtcatcgacacgatggacgaccgcctggcgctg
gcgaaagcgtttggcgccgacgtggtcatcaatgcggcgcaagaggacgccatcgctatc
gtaaaatccatgaccgatggctacggctgcgatgtgtatatcgaagcgacgggcgcccct
atcggcgtgacccagggtctggagatgattcgtaagctgggacgcttcgttgagttcagc
gtgtttggtaaagaaacgaccgccgactggtcgattattggcgaccgtaaagagctggat
atccgcggcgcgcatctggggccttacagctatgaaatcgccatcgatctctttgcgcgc
ggtctgctgaccgccaaaggcgtggtgacgcatttctattctattgatgagtggaaagcc
gcttttgagatggctaaatcgctcgattcgattaaggtcgtcattaagccataa

DBGET integrated database retrieval system