KEGG   Klebsiella oxytoca CAV1374: AB185_28035Help
Entry
AB185_28035       CDS       T04534                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
koc  Klebsiella oxytoca CAV1374
Brite
KEGG Orthology (KO) [BR:koc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AB185_28035
Enzymes [BR:koc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AB185_28035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Thi4 DAO K_oxygenase NAD_binding_8 FAD_binding_3 FMO-like Glutaredoxin AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AKL37510
UniProt: A0A0G3SCJ1
LinkDB All DBs
Position
complement(4815566..4817131)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDGAKSAEIRELLAEIAELSDKVTFKEDNGLAV
RKPSFLITNPGSSQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQTLLEQIRNIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTYQNEITERNVMGVPAVFMNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEELNKREAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSEYDVDVIDSQSASRLIPATVEG
GLHQVETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVVGD
GSKVTGLQYRDRVSGDEHHVALSGIFVQIGLLPNTNWLEGAIERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcttatcttgagaagctgaccaaacct
gttgagctgattgccacgctggatgacggcgctaaatcggcagaaatcagggaactgctg
gctgaaattgctgaactgtcagataaagttaccttcaaagaagataacggcctggcggtg
cgtaagccgtcattcctgattaccaatcccggctccagccaggggccgcgctttgccggc
tctccgctgggacatgaattcacctctttagttctggctctgctgtggaccggcggtcat
ccgtcaaaagaagcgcagaccctgctggagcagatccgcaatatcgacggtgattttgag
ttcgaaacctactattcgctttcatgccataactgcccggatgtggttcaggcgctgaac
ctgatggcggtactgaacccgcgcatcaagcacacggcgattgacggcggaacgtatcag
aatgaaatcaccgaacgcaacgtgatgggcgtaccggcggtatttatgaacggtaaggaa
tttggtcagggtcgcatgacgctgacggaaatcgttgccaaagtggataccggcgcggaa
aaacgcgcggcggaagagctgaataaacgtgaagcctatgatgtgttaatcgtcggctcc
ggcccgtccggcgcagcggcagccgtttactccgcgcgtaaaggcattcgtaccggcctg
atgggtgaacgctttggcggccaggtgctggataccgttgatattgaaaactatatttcc
gtacccaaaacggaaggccagaaactggctggcgcattaaaagcgcacgtcagcgaatac
gatgttgatgtgatcgattctcagagcgcctccagactgatcccggcgacggttgaaggc
ggcctgcatcaggttgagaccgcctccggcgcggtgctgaaagcgcgtagcgttatcatt
gccaccggcgcgaaatggcgtaacatgaacgtgccgggtgaggatcagtatcgtaccaag
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaagcgcgtggcggtt
atcggcggcggtaactccggtgtggaagcggcaatcgatctggctggcgttgttgaacat
gttactctgctggagttcgcgccggaaatgaaggccgaccaggttctgcaggataaagtc
cgcagcctgaaaaacgtcgatatcattctcaacgcgcagaccacggaagtggtgggcgac
ggtagcaaagtcactggcctgcagtaccgcgaccgcgtgagcggcgatgagcatcatgtt
gcgctgtcggggatcttcgtgcagatcggtctgctgccgaataccaactggctggaaggc
gcgattgagcgcaaccgcatgggtgaaatcatcattgatgcgaaatgtgaaaccaacgtg
aagggcgttttcgctgccggcgactgcacgaccgttccgtacaaacagattattatcgcc
accggcgaaggtgcgaaggcgtccttgagctcgttcgattacctgattcgcactaagact
gcataa

DBGET integrated database retrieval system