KEGG   Klebsiella oxytoca CAV1374: AB185_29890Help
Entry
AB185_29890       CDS       T04534                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
koc  Klebsiella oxytoca CAV1374
Pathway
koc00730  Thiamine metabolism
koc00790  Folate biosynthesis
koc01100  Metabolic pathways
koc02020  Two-component system
Module
koc_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:koc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AB185_29890
   00790 Folate biosynthesis
    AB185_29890
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AB185_29890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:koc04147]
    AB185_29890
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:koc00537]
    AB185_29890
Enzymes [BR:koc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AB185_29890
Exosome [BR:koc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AB185_29890
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:koc00537]
 Enzymes
  AB185_29890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme PT-VENN Phosphodiest Sulfatase
Motif
Other DBs
NCBI-ProteinID: AKL37865
UniProt: A0A0G3SDL5
LinkDB All DBs
Position
complement(5238104..5239534)
Genome map
AA seq 476 aa AA seqDB search
METIKVKLSALFIALLPLLGSPIIHAETTTAPVLENRAAQGDITTPGGARRLSGDQTEAL
RASLINKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKT
GKPDYVTDSAASATAWTTGVKSYNGALGVDIHEKDHQTILELAKAAGLATGNVSTAELQD
ATPAALVAHVTSRKCYGPSVTSEKCASNALEKGGKGSITEQLLNARPDVTLGGGAKTFAE
SATAGEWQGKTLHDQAVARGYQIVTDASSLAAISQANQDKPLLGLFAEGNMPVRWEGPKA
SYHGNIDKAAVTCTPNPKRDASVPTLAQMTEKAIDLLSSNEKGFFLQVEGASIDKQDHAA
NPCGQIGETVDLDEAVQKALEFAKKEGNTLVIVTADHAHASQIIPADTKAPGLTQALNTK
DGSVMVMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKAALNLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagacgataaaagtgaaattaagcgccctgtttattgccctgctgcctctgctgggc
tccccgattattcacgcagaaacaacaaccgcaccggttctggaaaatcgtgccgcgcag
ggcgatatcaccacgccgggcggcgcgcgtcgtttaagcggtgaccagaccgaggcgctg
cgcgcttcgttaatcaataaaccggctaaaaatattattttgctgattggcgacggaatg
ggcgattctgaaatcaccgccgcgcgaaattatgcagaaggggcgggcggcttctttaaa
ggcattgacgcgctgccgctgaccggccagtacacccattattctctggataagaaaacc
ggcaagccggattatgtcaccgactccgccgcttccgcaacggcctggaccaccggcgtg
aaaagctataacggcgcgctgggcgtggatatccatgaaaaagatcatcagaccatcctt
gagctggcgaaagcggcgggcttagccaccggtaacgtctccacggcggaactgcaggac
gccactcccgctgcgctggtggcgcatgtgacgtcgcgtaaatgctacggcccgagcgtg
accagcgaaaaatgcgccagcaacgcgctggaaaagggcggtaaaggttcgattaccgaa
cagctgctgaacgcccgtcccgacgtaacactgggcggcggcgcgaaaaccttcgcggaa
agcgcgacggccggtgaatggcagggcaaaacgctgcacgatcaggcggtagcccgcggc
taccagatcgtcaccgacgccagctcgctggccgccattagccaggccaatcaggacaaa
ccgctgctcggtctcttcgcggaaggcaatatgccggtgcgttgggaaggcccaaaggcg
tcttatcacggcaatatcgataaggcggcggtgacctgtacgccgaacccgaaacgcgat
gcatcggtgccgacgctggcgcagatgaccgaaaaagccatcgatctgctgagcagcaat
gagaaggggttcttcctgcaggtggaaggcgcttctatcgataaacaggatcacgcggcg
aatccgtgcggtcagattggcgagaccgtcgatctggacgaagcggtacagaaggcgctg
gaatttgccaaaaaagagggcaataccctggttatcgtcaccgccgaccacgctcacgcc
agccagattatcccggcagataccaaagcgccgggcctgacgcaggcgctgaacaccaaa
gatggttcggtgatggtgatgagctacggcaactctgaagaagagtcgatggaacatacc
ggcacccagctgcgtattgccgcctacggcccgcacgcggccaacgtggtgggtttaacc
gaccagacggacctgttctacaccatgaaagccgcacttaatctgaaataa

DBGET integrated database retrieval system