KEGG   Klebsiella michiganensis E718: A225_0895Help
Entry
A225_0895         CDS       T02173                                 

Definition
(GenBank) UDP-N-acetylmuramate-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00471  D-Glutamine and D-glutamate metabolism
koe00550  Peptidoglycan biosynthesis
koe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    A225_0895
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A225_0895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:koe01011]
    A225_0895
Enzymes [BR:koe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     A225_0895
Peptidoglycan biosynthesis and degradation proteins [BR:koe01011]
 Precursor biosynthesis
  Amino acid ligase
   A225_0895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AFN30713
LinkDB All DBs
Position
951669..953144
Genome map
AA seq 491 aa AA seqDB search
MNTQDLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDLAPNPVTQQL
TQLGATIYFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIPVIRRAEMLAELMRFRH
GIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLGHSRYLIAEADESDA
SFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRELL
PRVGRQLTTYGFSDDADVRVEEYRQVGAQGHFRLVRQDKEVIQVTLNAPGRHNALNAAAA
VAVATEEGIDDDAILRALESFQGTGRRFDFLGEYPLAEVNGKEGTAMLIDDYGHHPTEVD
ATIKAARAGWPDKNLVMLFQPHRFTRTRDLYDDFANVLTQVDALLMLDVYSAGEAAIPGA
DSRSLCRTIRGRGKVDPILVSDPAQAAEMLASVLTGNDLVLVQGAGNIGKIARHLAEIKL
QPQKSQEERHG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacaagatctggcaaaactgcgttctatcgtgcccgagatgcgtcgcgtccgg
cacattcactttgttggcattggcggtgccggcatgggcggtattgccgaagttctggcc
aacgaaggttatcagattagcggctccgacctggcgccgaatccggtgacccagcagttg
actcagcttggcgccacgatttatttcaaccatcgccctgaaaacgtgcgcgatgcgagc
gttgtcgtggtttccagcgcgatttctgcggataacccggaaatcgtcgccgcccacgaa
gcgcgtattccggttattcgccgcgccgagatgctggcggagctgatgcgttttcgccac
ggcattgccattgccggcacgcacggaaagaccacaaccacggcgatggtctcgagcatt
tacgctgaagccgggctggatcctaccttcgtgaacggtggtctggtcaaagccgctggc
gtgcacgcgcgccttggccatagtcgttacctgattgccgaagcggacgaaagcgacgcc
tcgttcctgcatttacagccgatggtcgctatcgtgaccaatatcgaagccgatcatatg
gatacctaccacggcgacttcgaaaacctgaagcagacgtttattaacttcctgcacaat
ctgccgttctacggacgcgcggtgatgtgcgtggacgatccggtgattcgtgaactgctg
ccgcgcgttggccgccagctcaccacctacggatttagcgatgatgccgacgttcgcgtg
gaagagtatcgtcaggttggcgctcagggccatttccgtctggttcgccaggataaagag
gtcattcaggtgacgctgaacgcaccgggtcgccacaacgcgctgaacgcggcggcggcg
gtggccgttgccacggaagagggcattgatgatgacgctattttgcgcgcgctggaaagc
ttccagggcaccggccgtcgctttgatttccttggcgaataccccttagctgaagttaac
ggtaaagagggtaccgcgatgctgatcgatgattatggtcatcatcctacagaagtggat
gccaccatcaaagcggcgcgggcgggctggccggataaaaacctggtgatgctgtttcag
ccgcaccgttttacccgtacgcgcgatctgtacgatgatttcgccaacgtgctgacccag
gttgacgcgctgctgatgctggacgtttattccgcgggcgaagccgctattcctggcgcc
gacagccgctcgctgtgccgtacgattcgcggccgcggtaaagtcgacccgattctggtt
tccgacccggcgcaggcggcagagatgctggcttcagtattgaccggcaacgatctggtg
ctggttcagggggcgggaaacattggtaaaatcgcccgtcacctggcggaaatcaaattg
cagccgcaaaaatcgcaggaggagcgccatggctga

DBGET integrated database retrieval system