KEGG   Klebsiella michiganensis E718: A225_1199Help
Entry
A225_1199         CDS       T02173                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00473  D-Alanine metabolism
koe00550  Peptidoglycan biosynthesis
koe01100  Metabolic pathways
koe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A225_1199
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A225_1199
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A225_1199
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:koe01011]
    A225_1199
Enzymes [BR:koe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A225_1199
Peptidoglycan biosynthesis and degradation proteins [BR:koe01011]
 Precursor biosynthesis
  Amino acid ligase
   A225_1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST RimK GARS_A NHase_alpha
Motif
Other DBs
NCBI-ProteinID: AFN30979
LinkDB All DBs
Position
complement(1273617..1274729)
Genome map
AA seq 370 aa AA seqDB search
MMEVEMAKMRVGIVFGGKSAEHEVSLQSAKNIVEAIDKTRFDVVLLGIDKQGQWHINDAS
NYLLNPQDPAHIALRPSDITLAQIPGREAQQLINADSGQPLAAIDVIFPIVHGTLGEDGS
LQGMLRMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLSIAPFITLTRANRHQVSFAEVQ
AKLGLPLFVKPANQGSSVGVSKVNSEEQYQQAVALAFEFDHKVVVEQGIKGREIECAVLG
NDNPQASTCGEIVLNSEFYAYDTKYIDDQGAKVVVPAAIDSDVNDKIRDIAVRAYQTLGC
SGMARVDVFLTADNDVVINEINTLPGFTNISMYPKLWQASGLDYTSLISRLIELALERHA
ADRALKTSMN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagttgaaatggctaagatgagggttgggatcgttttcggcggtaagtcggca
gaacatgaagtatcgctacagtcagcgaaaaatatcgtggaagccatcgacaaaacgcgc
ttcgacgtcgttttgctggggattgataagcaggggcagtggcatatcaacgacgccagc
aactatctgctcaatccgcaggaccccgcccatattgccctgcgcccatccgatattacc
ctggcgcaaattcccggacgcgaagcgcagcagctgattaacgccgatagcggccagccg
ctggcggccatcgacgtcattttcccgattgttcacggcacccttggggaagatggttct
ctgcagggtatgctgcggatggctaacctgcccttcgtcggctccgacgtcctcggctcc
gccgcctgcatggacaaagacgtgaccaagcgtctgctgcgcgatgccgggctgtcgatt
gcgccttttattaccctgacccgcgccaaccgtcatcaggtgagctttgccgaagtgcag
gcgaagctgggcctgccgctgttcgtcaaaccggcgaaccagggctcctcggtgggcgtc
agcaaggtcaacagcgaagagcagtatcagcaggccgtcgccctggccttcgaatttgac
cataaagtggtggttgaacaggggattaaagggcgtgagatcgagtgcgcggtattgggc
aacgataatccccaggccagcacctgcggtgaaatcgtcctcaacagcgaattctacgcc
tatgacaccaagtacattgacgatcagggcgcgaaggtggtggttccggcggccatcgac
agcgatgtaaacgataaaattcgcgatatcgccgttcgcgcctatcagaccctcggctgc
agcgggatggcgcgcgtcgatgtgttcctgaccgccgataacgacgtggtgattaacgaa
atcaatacgctgccgggcttcaccaacatcagcatgtatccgaagctatggcaggccagc
ggtctggactataccagcctgattagccgcctgattgagctggcgcttgagcgtcacgcc
gccgatcgggcgctgaaaacatcgatgaattaa

DBGET integrated database retrieval system