KEGG   Klebsiella michiganensis E718: A225_1206Help
Entry
A225_1206         CDS       T02173                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00730  Thiamine metabolism
koe00790  Folate biosynthesis
koe01100  Metabolic pathways
koe02020  Two-component system
Module
koe_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    A225_1206
   00790 Folate biosynthesis
    A225_1206
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A225_1206
Enzymes [BR:koe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A225_1206
Exosome [BR:koe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A225_1206
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:koe00537]
 Enzymes
  A225_1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme PT-VENN Phosphodiest Sulfatase
Motif
Other DBs
NCBI-ProteinID: AFN30985
LinkDB All DBs
Position
1280842..1282257
Genome map
AA seq 471 aa AA seqDB search
MKLSALFIALLPLLGSPIIHAETTTAPVLENRAAQGDITTPGGARRLSGDQTEALRASLI
NKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKTGKPDY
VTDSAASATAWTTGVKSYNGALGVDIHEKDHQTILELAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTSEKCASNALEKGGKGSITEQLLNARPDVTLGGGAKTFAESATAG
EWQGKTLHDQAVARGYQIVTDASSLAAISQANQDKPLLGLFAEGNMPVRWEGPKASYHGN
IDKAAVTCTPNPKRDASVPTLAQMTEKAIDLLSSNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFAKKEGNTLVIVTADHAHASQIIPADTKAPGLTQALNTKDGSVM
VMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKAALNLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaagcgccctgtttattgccctgctgcctctgctgggctccccgattattcac
gcagaaacaacaaccgcaccggttctggaaaatcgtgccgcgcagggcgatatcaccacg
ccgggcggcgcgcgtcgtttaagcggtgaccagaccgaggcgctgcgcgcttcgttaatc
aataaaccggctaaaaatattattttgctgattggcgacggaatgggcgattctgaaatc
accgccgcgcgaaattatgcagaaggggcgggcggcttctttaaaggcattgacgcgctg
ccgctgaccggccagtacacccattattctctggataagaaaaccggcaagccggattat
gtcaccgactccgccgcttccgcaacggcctggaccaccggcgtgaaaagctataacggc
gcgctgggcgtggatatccatgaaaaagatcatcagaccatccttgagctggcgaaagcg
gcgggcttagcaaccggtaacgtctccacggcggaactgcaggacgccactcccgctgcg
ctggtggcgcatgtgacgtcgcgtaaatgctacggcccgagcgtgaccagcgaaaaatgc
gccagcaacgcgctggaaaagggcggtaaaggttcgattaccgaacagctgctgaacgcc
cgtcccgacgtaacactgggcggcggtgcgaaaaccttcgcggaaagcgcgacggccggt
gaatggcagggcaaaacgctgcacgatcaggcggtagcccgcggctaccagatcgtcacc
gacgccagctcgctggccgccattagccaggccaatcaggacaaaccgctgctcggtctc
ttcgcggaaggcaatatgccggtgcgttgggaaggcccaaaggcgtcttatcacggcaat
atcgataaggcggcggtgacctgtacgccgaacccgaaacgcgatgcatcggtgccgacg
ctggcgcagatgaccgaaaaagccatcgatctgctgagcagcaatgagaaggggttcttc
ctgcaggtggaaggcgcttctatcgataaacaggatcacgcggcgaatccgtgcggtcag
attggcgagaccgtcgatctggacgaagcggtacagaaggcgctggaatttgccaaaaaa
gagggcaataccctggttatcgtcaccgccgaccacgctcacgccagccagattatcccg
gcagataccaaagcgccgggcctgacgcaggcgctgaacaccaaagatggttcggtgatg
gtgatgagctacggcaactctgaagaagagtcgatggaacataccggcacccagctgcgt
attgccgcctacggcccgcacgcggccaacgtggtgggtttaaccgaccagacggacctg
ttctacaccatgaaagccgcacttaatctgaaataa

DBGET integrated database retrieval system