KEGG   Klebsiella michiganensis E718: A225_1526
Entry
A225_1526         CDS       T02173                                 

Definition
(GenBank) PTS system protein
  KO
K11196  fructose PTS system EIIC component
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00051  Fructose and mannose metabolism
koe02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A225_1526
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    A225_1526
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:koe02000]
    A225_1526
Transporters [BR:koe02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    A225_1526
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: AFN29373
LinkDB
Position
1601219..1602019
AA seq 266 aa
MTTIQIILLLVIAAITGMGSVLDEGQTHRPLVACTLVGWVLGDMTTGIILGGTLEMMALG
WMNVGLAMAPDTAIASVISTILVINTNQGIGEGIAIAVALAAAGQALTIFVRTMTVFLIH
RADTYAEKGNMRGIEIMHITALGFQALRVMIPTFVVVMMSVDSVQAMLNGIPPVVTHGLQ
IGGGIIVVVGYAMVINMMSVKYLMPFFFAGFLIAAFTSFNLVGLGGMGLVGALLYIQLSP
KYQPKTLTAVADGGPASLNNNDDLDA
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaccactatacaaattatattgctgctggtgattgcagccattaccgggatgggtagc
gtgctggatgaagggcaaacgcatcgtccacttgttgcctgtacgctggttggctgggta
cttggcgatatgactaccggtatcattcttggcggtacgctggaaatgatggccctcggg
tggatgaacgttgggctggcgatggcgccggataccgccatcgcctcggtgatatcgacc
attctggtgattaatacaaatcaggggattggcgaaggcatcgcgattgccgtcgcgtta
gccgctgcgggtcaggcgctgacgatttttgtcagaacgatgacggtgttcttgatccac
cgggcggatacctatgctgaaaagggcaatatgcgcggtatcgaaatcatgcatatcact
gcgcttggtttccaggcgctgcgcgtgatgattcctacctttgtggtggtcatgatgagc
gttgattcggtgcaggccatgttgaacggtattccgccagtggtgacgcatggtctgcaa
attggcggcggtattattgttgttgtgggttatgccatggtcatcaatatgatgagcgtc
aaatatcttatgccgttcttttttgccggtttcttgattgcggcttttaccagtttcaac
cttgttggtttagggggaatgggattagtcggtgcgttgctgtatatacagctgagtcca
aaataccagcctaaaaccctgaccgccgtggcggatggtgggccggcttctttaaataat
aacgacgatttggatgcataa

DBGET integrated database retrieval system