KEGG   Klebsiella michiganensis E718: A225_2459Help
Entry
A225_2459         CDS       T02173                                 

Definition
(GenBank) putative zinc-type alcohol dehydrogenase-like protein YdjJ
Organism
koe  Klebsiella michiganensis E718
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N ThiF
Motif
Other DBs
NCBI-ProteinID: AFN32045
LinkDB All DBs
Position
2598597..2599655
Genome map
AA seq 352 aa AA seqDB search
MTGNKMKNSKAILKTPGTMKIIAADIPVPKEHEVLIKIEYVGICGSDVHGFESGPFIPPK
DPNQEIGLGHECAGTVVAVGKSVSKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFM
ATQPNYRGALTHYLCHPESFTYKLPDNMDTLEGALVEPAAVGMHAAMLANVKPGKKIVIL
GAGCIGLMTLQACLCLGATDIAVVDVLEKRLAMAEQLGAKVVINGAKEDTVGRCQQFSGD
MGADVVFETAGSAITVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVSIQTVFRYAN
RYPVTIEAISSGRFDVKSMVTHIYDFEDVQRAFDESVNNKREIIKGVIKVNH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgacgggcaataaaatgaaaaattcaaaagcgatattaaaaacaccgggcacgatgaaa
attatcgctgccgatatcccggtacccaaagaacatgaagtgctgatcaaaattgaatac
gtcggaatttgtggttcagatgtccacggttttgagtcggggccctttattccgccgaaa
gaccctaatcaggaaattggtctgggacacgaatgcgccggtacggtggtggccgtaggc
aaaagcgtgagcaaatttaagccgggcgaccgggtgaatattgaacccggcgtgccgtgc
ggccactgtcgctactgcctggagggaaaatacaatatctgtcccgacgtcgactttatg
gccacgcagccaaattatcgcggtgcgctaacccactatctatgccatccggagagcttc
acttacaaactgcccgataacatggacacccttgaaggcgctttggtggagcctgcggcg
gttggcatgcatgccgcaatgctggcgaacgtcaagccgggcaagaaaatcgtcatactt
ggcgcaggctgtattggcttaatgaccctgcaggcatgcctttgcctgggggcaaccgac
atcgcggtggttgatgtgctggaaaaacgccttgccatggccgaacagctcggagccaaa
gtcgttatcaacggcgcgaaagaggacaccgttgggcgctgccagcagttctccggcgat
atgggggccgatgttgtttttgaaacggccgggtcggccatcaccgttaagcaggctcct
tacctggtgatgcgcggaggaaaaatcatgatcgtcggtacggttcccggtgattcagcc
atcaatttcctcaaaattaaccgtgaggtctcgattcagaccgtcttccgctatgccaac
cgctatccggtcaccatagaagcgatctcctccgggcgtttcgatgtgaaatcgatggtg
acgcatatttatgattttgaggatgttcagcgcgcgtttgatgaatccgttaataacaaa
cgcgagattattaaaggcgttattaaagttaaccattaa

DBGET integrated database retrieval system