KEGG   Klebsiella michiganensis E718: A225_4745Help
Entry
A225_4745         CDS       T02173                                 

Definition
(GenBank) Cobalt-precorrin-6y C15-methyltransferase
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00860  Porphyrin and chlorophyll metabolism
koe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A225_4745
Enzymes [BR:koe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     A225_4745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 Cons_hypoth95 PrmA Methyltransf_4 GidB Methyltransf_25 PCMT CMAS Methyltransf_12 Methyltransf_11 Methyltransf_2 Met_10 Methyltransf_18 Methyltransf_23 RrnaAD Methyltr_RsmB-F DOT1 Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: AFN33969
LinkDB All DBs
Position
complement(4980120..4980689)
Genome map
AA seq 189 aa AA seqDB search
MKDELFLRGEKVPMTKEAVRALALAKLELHRASHLIDIGAGTGSVSIEAALQYPSLQVTA
VERNPAALQLLDENRQHFACGNIEILPGEAPMVITERADAIFMGGSGGRLDELIDWSWQQ
LYPGGRLVMTFILQENLNAALDYLRLKGIEQVDCLQLNVSSLTALGSGHYFKPNNPVFVI
ACQKEENHG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgagctttttctgcgcggcgagaaggtgccgatgaccaaagaggcggttcgc
gcgctggcgctggccaaacttgagctacaccgggcaagccacctgattgatatcggcgcc
ggtaccggcagcgtgtcgattgaggcggcgctgcagtacccctcgctgcaggtaacggcg
gtcgaacgcaatcccgcggccctgcagctgctggacgaaaaccgccagcatttcgcctgc
ggcaacattgagatcctgcccggcgaagcgccgatggtgatcaccgagcgggccgacgcc
atttttatgggcggcagcggcggccgcctcgacgagctcattgactggtcgtggcagcag
ctctaccccggcggtcgcctggtgatgacctttatcctgcaggagaacctgaacgccgct
ctcgactatctgcggctgaagggaatcgaacaggttgattgcctgcagctgaacgtttca
tcgctgaccgcgctgggcagcggccactatttcaaaccgaataatcccgtttttgttatc
gcctgtcagaaggaagaaaaccatggctga

DBGET integrated database retrieval system