KEGG   Klebsiella michiganensis E718: A225_5157
Entry
A225_5157         CDS       T02173                                 

Definition
(GenBank) Galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00052  Galactose metabolism
koe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A225_5157
Enzymes [BR:koe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     A225_5157
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 TrkA_N MTS Methyltransf_31 UDPG_MGDP_dh_N PrmA CoA_binding ELFV_dehydrog 3HCDH_N Methyltransf_11 Shikimate_DH Pyr_redox_2
Other DBs
NCBI-ProteinID: AFN34318
LinkDB
Position
5404991..5406034
AA seq 347 aa
MQSVVIHAEGTVRVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGSAVTDLQPGDAVACVPLLPCFNCPQCQREYFSLCKQYQFVGSRSEGGNAQY
VVVKRANLFRLPDQMPIDDGAFIEPMTVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGAKSITAIDINPQKLALAKTLGATHVFNSKEMSGKQIQTALEEIQFDQLVLETAGTP
QTVALGIEVAGPRAQLALVGTLHHDLTLPFATFGQILRKELTIVGSWMNYSGPWPGKEWQ
TAVRLLTEKRIQLAPLITHIGDAESFAREVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgcaatcagtggttatccatgctgaggggacagtgcgcgttgaagaacgcccgataccg
actctacaaacggaaaacgatgtcctggtcaaagtcgtcagctccggattgtgcggttcc
gatattccgcgcatcttcgccaaaggcgcccactactatcccatcaccctgggtcatgag
ttcagcggctatgttgaatcttacggctcagcggtgaccgacctgcagccgggcgacgcg
gtagcctgcgtgcctctgctcccctgctttaactgcccccagtgccagcgcgaatacttc
tctctctgcaaacagtaccagtttgtcggttcgcgcagcgaaggcggaaatgcgcagtac
gtggtggtcaaacgcgccaacctgttccgtctgccggaccagatgccgattgatgacggc
gcgtttattgaaccgatgaccgtcggcctgcacgccttccatctggctcagggctgcgaa
gggaaaaacgtcattattattggcgcaggcacaatcggtttgctggcgttgcagtgcgcc
cgcgaactgggcgccaaaagcattacggcaatcgatatcaacccgcagaagctggcgctg
gcaaaaacgctcggcgcaacgcacgtctttaacagcaaggagatgagcggcaaacagatt
caaacggcgctggaagagattcagttcgaccagctggtgctggaaaccgccggtacgccg
caaaccgtggcgctgggcattgaggtcgccggaccgcgcgcgcagctggcgctggtgggt
accttgcaccatgacttaacgctgcctttcgccacctttggccagattcttcgaaaagag
ctgactattgtcggcagctggatgaactactcgggcccgtggcctggaaaagagtggcaa
acggcggttcgcctgctgacggaaaaacgcattcagcttgccccgcttatcacccacatc
ggcgatgccgaaagctttgcccgcgaagtccaggcgctcaacggtgcgccgatgcagggg
aaaatcctgcttaaactctcctga

DBGET integrated database retrieval system