KEGG   Klebsiella michiganensis E718: A225_5441Help
Entry
A225_5441         CDS       T02173                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00250  Alanine, aspartate and glutamate metabolism
koe00410  beta-Alanine metabolism
koe00640  Propanoate metabolism
koe00650  Butanoate metabolism
koe01100  Metabolic pathways
koe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A225_5441
   00650 Butanoate metabolism
    A225_5441
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A225_5441
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A225_5441
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:koe01007]
    A225_5441
Enzymes [BR:koe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A225_5441
Amino acid related enzymes [BR:koe01007]
 Aminotransferase (transaminase)
  Class III
   A225_5441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFN34551
LinkDB All DBs
Position
complement(5669499..5670764)
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCSYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
IVAAVEQQLQAFTHTAYQIVPYESYVTLAERINELAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGITTA
DAMKSLERIFKADIAADQVAAIVLEPIQGEGGFNVAPPEFMQALRALCDTHGILLIADEV
QTGFARTGKLFAMQHYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEQLCQRAERLGSHLKEVLNQARQSCPAIADVRGQGSMVAVEFND
PQTGEPSAEITRQIQQQAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFTKALDILARVLK
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagttcagaactgaatcagcgtcgccagcaggcgactccgcgcggcgtaggggtg
atgtgcagctactttgttgagaaagcggagaacgctacgctgtgggatattgaagggaat
gaggtgatcgatttcgccgccggcatcgcggtgctgaataccggccatcgccaccccaaa
atcgttgccgccgttgaacagcagctgcaggcctttacccacacggcttaccagattgtc
ccgtacgaaagctatgtcacgctggccgagcggattaacgaactggcgccgattgacggt
ccggcaaaaacggcgttctttaccaccggggcggaagccgttgaaaacgcggtgaaaatc
gcgcgcgcttataccggccgtccggggttgattaccttcggcggcggcttccacggccgt
acgtttatgaccatggcgctgaccggcaaagtggcgccttacaagattggtttcggcccg
ttcccgggctcggtttatcacgccgtctaccctaacgccgcccatggcattaccaccgcc
gacgcgatgaagagcctggagcgcattttcaaagcggatatcgcggccgaccaggtggcg
gcgattgtgctggagccgattcagggggaaggcggctttaacgttgccccgcctgagttt
atgcaggcgctgcgcgcgctgtgcgatacccacggcattctgctgattgccgatgaagta
caaaccggctttgcgcgcaccggcaagctatttgcgatgcagcactatgatgtgaagcct
gacctgatgacgatggccaaaagcctggccggcggtttcccgctctccggcgtggtaggt
cgcgccgaggtgatggatgcgcctgcgccgggcggtctgggcggcacctatgccggtaac
ccgctggcggtcgcggccgcacacgcggtgctggacgtgattgaagaagaacagctgtgc
cagcgcgctgagcgcttaggcagccatctgaaagaggtgctgaatcaggcgcgtcaaagc
tgcccggcgattgctgacgtacgcggccaggggtcgatggtggcggtagagtttaacgat
ccgcaaaccggcgagccgtcggcggagatcacccgtcaaatccagcaacaagcccaggag
aacggcctgctgctgctgagctgcggcgtctatggcaacgtcattcgcttcctctatccg
ttaacgattccggatgcgcagtttacgaaagcgctggatattctggcccgcgtgctgaag
ggctag

DBGET integrated database retrieval system