KEGG   Klebsiella michiganensis E718: A225_5611Help
Entry
A225_5611         CDS       T02173                                 

Definition
(GenBank) L-xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00040  Pentose and glucuronate interconversions
koe00053  Ascorbate and aldarate metabolism
koe01100  Metabolic pathways
koe01120  Microbial metabolism in diverse environments
Module
koe_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A225_5611
   00053 Ascorbate and aldarate metabolism
    A225_5611
Enzymes [BR:koe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     A225_5611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Glyco_hydro_114 UxuA PRMT5_TIM
Motif
Other DBs
NCBI-ProteinID: AFN34698
LinkDB All DBs
Position
5852993..5853853
Genome map
AA seq 286 aa AA seqDB search
MRNHPLGIYEKALAKDLSWPERLVLAKSCGFDFVEMSVDETDERLSRLEWTSAQRASLVS
AMLETGVAIPSMCLSAHRRFPFGSRDEAVRERAREIMTKAIRLARDLGIRTIQLAGYDVY
YEEHDEGTRQRFAEGLAWAVEQAAAAQVMLAVEIMDTAFMNSISKWKKWDERLSSPWFTV
YPDVGNLSAWGNDVTAELKLGIDRIAAIHLKDTLPVTDDSPGQFRDVPFGEGCVDFVGIF
KTLHELNYRGSFLIEMWTEKASEPVLEIIQARRWIESRMQEGGFIC
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaccacccgttaggtatttatgaaaaagcgctggcgaaggatctcagctggcct
gaacggctggtgctggccaaaagctgcggttttgattttgtcgaaatgtcggtggacgag
accgacgaacgcctttcgcgcctggagtggacatcggcccagcgggcatcgctggtgagc
gcgatgctggaaaccggcgtcgctattccctcaatgtgcctgtccgcccatcgccgtttc
ccctttggcagccgcgacgaggcggtacgcgagcgggcgcgggagattatgaccaaagcc
atccgcctggcgcgcgatctggggattcgtactattcagctggcgggttacgacgtctat
tacgaagagcacgatgaaggcacccggcagcgttttgccgaagggctggcctgggcggta
gaacaggccgccgccgcgcaggtgatgctggcggtggagatcatggacaccgcctttatg
aactccatcagcaaatggaaaaagtgggacgagaggctttcgtcaccgtggtttaccgtc
tatccggacgtcggcaacctcagcgcctgggggaacgacgtcaccgccgagctgaaactg
ggtatcgatcgtatcgccgccatccacctgaaggacacgctgcccgtgaccgacgatagc
ccgggccagttccgcgacgtgccgttcggtgaaggatgcgttgattttgtcggcatcttt
aagacgctgcatgagctgaactaccgcggttcgtttctgattgagatgtggacggagaag
gccagcgaaccggtactggagattatccaggcccggcgctggattgaatcacggatgcag
gaaggaggtttcatatgttag

DBGET integrated database retrieval system