KEGG   Klebsiella oxytoca KONIH1: KONIH1_01390Help
Entry
KONIH1_01390      CDS       T03269                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
kok  Klebsiella oxytoca KONIH1
Brite
Translation factors [BR:kok03012]
 Eukaryotic Type
  Elongation factors
   KONIH1_01390 (tuf)
 Prokaryotic Type
   KONIH1_01390 (tuf)
Mitochondrial biogenesis [BR:kok03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    KONIH1_01390 (tuf)
Exosome [BR:kok04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KONIH1_01390 (tuf)
  Exosomal proteins of breast cancer cells
   KONIH1_01390 (tuf)
  Exosomal proteins of colorectal cancer cells
   KONIH1_01390 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AID87755
LinkDB All DBs
Position
276988..278172
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDADWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgttctggctaaaacctac
ggtggttctgctcgcgcattcgaccagatcgataacgcgccggaagaaaaagctcgtggt
atcaccatcaacacttctcacgttgaatatgacaccccgactcgccactacgcgcacgta
gactgcccgggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggat
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgaaatggaagttcgtgaacttctgtctcag
tacgatttcccgggcgacgacactccgatcgttcgcggttccgctctgaaagcgctggaa
ggtgacgcagactgggaagcgaaaattatcgaactggctggctacctggattcttacatc
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagttggc
gaagaagttgaaatcgttggtatcaaagagactgcgaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggttctatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtacaactgacgtgactggc
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggt
ggccgtaccgtcggcgcgggcgtggttgctaaagttctcggctaa

DBGET integrated database retrieval system