KEGG   Klebsiella oxytoca KONIH1: KONIH1_04665Help
Entry
KONIH1_04665      CDS       T03269                                 

Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00471  D-Glutamine and D-glutamate metabolism
kok00550  Peptidoglycan biosynthesis
kok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kok00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    KONIH1_04665
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KONIH1_04665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kok01011]
    KONIH1_04665
Enzymes [BR:kok01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     KONIH1_04665
Peptidoglycan biosynthesis and degradation proteins [BR:kok01011]
 Precursor biosynthesis
  Amino acid ligase
   KONIH1_04665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AID88376
LinkDB All DBs
Position
984937..986412
Genome map
AA seq 491 aa AA seqDB search
MNTQDLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQISGSDLAPNPVTQQL
TQLGATIYFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIPVIRRAEMLAELMRFRH
GIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHARLGHSRYLIAEADESDA
SFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLPFYGRAVMCVDDPVIRELL
PRVGRQLTTYGFSDDADVRVEEYRQVGAQGHFRLVRQDKEVIQVTLNAPGRHNALNAAAA
VAVATEEGIDDDAILRALESFQGTGRRFDFLGEYPLAEVNGKEGTAMLIDDYGHHPTEVD
ATIKAARAGWPDKNLVMLFQPHRFTRTRDLYDDFANVLTQVDALLMLDVYSAGEAAIPGA
DSRSLCRTIRGRGKVDPILVSDPAQAAEMLASVLTGNDLVLVQGAGNIGKIARHLAEIKL
QPQKSQEERHG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacaagatctggcaaaactgcgttctatcgtgcccgagatgcgtcgcgtccgg
cacattcactttgttggcattggcggtgccggcatgggcggtattgccgaagttctggcc
aacgaaggttatcagattagcggctccgacctggcgccgaatccggtgacccagcagttg
actcagcttggcgccacgatttatttcaaccatcgccctgaaaacgtgcgcgatgcgagc
gttgtcgtggtttccagcgcgatttctgcggataacccggaaatcgtcgccgcccacgaa
gcgcgtattccggttattcgccgcgccgagatgctggcggagctgatgcgttttcgccac
ggcattgccattgccggcacgcacggaaagaccacaaccacggcgatggtctcgagcatt
tacgctgaagccgggctggatcctaccttcgtgaacggtggtctggtcaaagccgctggc
gtgcacgcgcgccttggccatagtcgttacctgattgccgaagcggacgaaagcgacgcc
tcgttcctgcatttacagccgatggtcgctatcgtgaccaatatcgaagccgatcatatg
gatacctaccacggcgacttcgaaaacctgaagcagacttttattaacttcctgcacaat
ctgccgttctacggacgcgcggtgatgtgcgtggacgatccggtgattcgtgaactgctg
ccgcgcgttggccgccagctcaccacctacggatttagcgatgatgccgacgttcgcgtg
gaagagtatcgtcaggttggcgctcagggccatttccgtctggttcgccaggataaagag
gtcattcaggtgacgctgaacgcaccgggtcgccacaacgcgctgaacgcggcggcggcg
gtggccgttgccacggaagagggcattgatgatgacgctattttgcgcgcgctggaaagc
ttccagggcaccggccgtcgctttgatttccttggcgaataccccttagctgaagttaac
ggtaaagagggtaccgcgatgctgatcgatgattatggtcatcatcctacagaagtggat
gccaccatcaaagcggcgcgggcgggctggccggataaaaacctggtgatgctgtttcag
ccgcaccgttttacccgtacgcgcgatctgtacgatgatttcgccaacgtgctgacccag
gttgacgcgctgctgatgctggacgtttattccgcgggcgaagccgctattcctggcgcc
gacagccgctcgctgtgccgtacgattcgcggccgcggtaaagtcgacccgattctggtt
tccgacccggcgcaggcggcagagatgctggcttcagtattgaccggcaacgatctggtg
ctggttcagggggcgggaaacattggtaaaatcgcccgtcacctggcggaaatcaaattg
cagccgcaaaaatcgcaggaggagcgccatggctga

DBGET integrated database retrieval system