KEGG   Klebsiella oxytoca KONIH1: KONIH1_06305Help
Entry
KONIH1_06305      CDS       T03269                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00473  D-Alanine metabolism
kok00550  Peptidoglycan biosynthesis
kok01100  Metabolic pathways
kok01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kok00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KONIH1_06305
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KONIH1_06305
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    KONIH1_06305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kok01011]
    KONIH1_06305
Enzymes [BR:kok01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KONIH1_06305
Peptidoglycan biosynthesis and degradation proteins [BR:kok01011]
 Precursor biosynthesis
  Amino acid ligase
   KONIH1_06305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST RimK GARS_A NHase_alpha
Motif
Other DBs
NCBI-ProteinID: AID88682
LinkDB All DBs
Position
complement(1332589..1333719)
Genome map
AA seq 376 aa AA seqDB search
MPFDVIMMEVEMAKMRVGIVFGGKSAEHEVSLQSAKNIVEAIDKTRFDVVLLGIDKQGQW
HINDASNYLLNPQDPAHIALRPSDITLAQIPGREAQQLINADSGQPLAAIDVIFPIVHGT
LGEDGSLQGMLRMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLSIAPFITLTRANRHQV
SFAEVQAKLGLPLFVKPANQGSSVGVSKVNSEEQYQQAVALAFEFDHKVVVEQGIKGREI
ECAVLGNDNPQASTCGEIVLNSEFYAYDTKYIDDQGAKVVVPAAIDSDVNDKIRDIAVRA
YQTLGCSGMARVDVFLTADNDVVINEINTLPGFTNISMYPKLWQASGLDYTSLISRLIEL
ALERHAADRALKTSMN
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgccctttgatgtaatcatgatggaagttgaaatggctaagatgagggttgggatcgtt
ttcggcggtaagtcggcagaacatgaagtatcgctacagtcagcgaaaaatatcgtggaa
gccatcgacaaaacgcgcttcgacgtcgttttgctggggattgataagcaggggcagtgg
catatcaacgacgccagcaactatctgctcaatccgcaggaccccgcccatattgccctg
cgcccatccgatattaccctggcgcaaattcccggacgcgaagcgcagcagctgattaac
gccgatagcggccagccgctggcggccatcgacgtcattttcccgattgttcacggcacc
cttggggaagatggttctctgcagggtatgctgcggatggctaacctgcccttcgtcggc
tccgacgtcctcggctccgccgcctgcatggacaaagacgtgaccaagcgtctgctgcgc
gatgccgggctgtcgattgcgccttttattaccctgacccgcgccaaccgtcatcaggtg
agctttgccgaagtgcaggcgaagctgggcctgccgctgttcgtcaaaccggcgaaccag
ggctcctcggtgggcgtcagcaaggtcaacagcgaagagcagtatcagcaggccgtcgcc
ctggccttcgaatttgaccataaagtggtggttgaacaggggattaaagggcgtgagatc
gagtgcgcggtattgggcaacgataatccccaggccagcacctgcggtgaaatcgtcctc
aacagcgaattctacgcctatgacaccaagtacattgacgatcagggcgcgaaggtggtg
gttccggcggccatcgacagcgatgtaaacgataaaattcgcgatatcgccgttcgcgcc
tatcagaccctcggctgcagcgggatggcgcgcgtcgatgtgttcctgaccgccgataac
gacgtggtgattaacgaaatcaatacgctgccgggcttcaccaacatcagcatgtatccg
aagctatggcaggccagcggtctggactataccagcctgattagccgcctgattgagctg
gcgcttgagcgtcacgccgccgatcgggcgctgaaaacatcgatgaattaa

DBGET integrated database retrieval system