KEGG   Klebsiella oxytoca KONIH1: KONIH1_06340Help
Entry
KONIH1_06340      CDS       T03269                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00730  Thiamine metabolism
kok00790  Folate biosynthesis
kok01100  Metabolic pathways
kok02020  Two-component system
Module
kok_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kok00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KONIH1_06340
   00790 Folate biosynthesis
    KONIH1_06340
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KONIH1_06340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kok04147]
    KONIH1_06340
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kok00537]
    KONIH1_06340
Enzymes [BR:kok01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KONIH1_06340
Exosome [BR:kok04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KONIH1_06340
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kok00537]
 Enzymes
  KONIH1_06340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Phosphodiest PT-VENN Sulfatase
Motif
Other DBs
NCBI-ProteinID: AID88689
LinkDB All DBs
Position
1339815..1341230
Genome map
AA seq 471 aa AA seqDB search
MKLSALFIALLPLLGSPIIHAETTTAPVLENRAAQGDITTPGGARRLSGDQTEALRASLI
NKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKTGKPDY
VTDSAASATAWTTGVKSYNGALGVDIHEKDYQTILELAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTSEKCASNALEKGGKGSITEQLLNARPDVTLGGGAKTFAESATAG
EWQGKTLHDQAVARGYQIVTDASSLAAISQANQDKPLLGLFAEGNMPVRWEGPKASYHGN
IDKAAVTCTPNPKRDASVPTLAQMTEKAIDLLSSNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFAKKEGNTLVIVTADHAHASQIIPADTKAPGLTQALNTKDGSVM
VMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKAALNLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaagcgccctgtttattgccctgctgcctctgctgggctccccgattattcac
gcagaaacaacaaccgcaccggttctggaaaatcgtgccgcgcagggcgatatcaccacg
ccgggcggcgcgcgtcgtttaagcggtgaccagaccgaggcgctgcgcgcttcgttaatc
aataaaccggctaaaaatattattttgctgattggcgacggaatgggcgattctgaaatc
accgccgcgcgaaattatgcagaaggggcgggcggcttctttaaaggcattgacgcgctg
ccgctgaccggccagtacacccattattctctggataagaaaaccggcaagccggattat
gtcaccgactccgccgcttccgcaacggcctggaccaccggcgtgaaaagctataacggc
gcgctgggcgtggatatccatgaaaaagattatcagaccatccttgagctggcgaaagcg
gcgggcttagccaccggtaacgtctccacggcggaactgcaggacgccactcccgctgcg
ctggtggcgcatgtgacgtcgcgtaaatgctacggcccgagcgtgaccagcgaaaaatgc
gccagcaacgcgctggaaaagggcggtaaaggttcgattaccgaacaactgctgaacgcc
cgtcccgacgtaacactgggcggcggcgcgaaaaccttcgcggaaagcgcgacggccggt
gaatggcagggcaaaacgctgcacgatcaggcggtagcccgcggctaccagatcgtcacc
gacgccagctcgctggccgccattagccaggccaatcaggacaaaccgctgctcggtctc
ttcgcggaaggcaatatgccggtgcgttgggaaggcccaaaggcgtcttatcacggcaat
atcgataaggcggcggtgacctgtacgccgaacccgaaacgcgatgcatcggtgccgacg
ctggcgcagatgaccgaaaaagccatcgatctgctgagcagcaatgagaaggggttcttc
ctgcaggtggaaggcgcttctatcgataaacaggatcacgcggcgaatccgtgcggtcag
attggcgagaccgtcgatctggacgaagcggtacagaaggcgctggaatttgccaaaaaa
gagggcaataccctggttatcgtcaccgccgaccacgctcacgccagccagattatcccg
gcagataccaaagcaccgggcctgacgcaggcgctgaacaccaaagatggttcggtgatg
gtgatgagctacggcaactctgaagaagagtcgatggaacataccggcacccagctgcgt
attgccgcctacggcccgcacgcggccaacgtggtgggtttaaccgaccagacggacctg
ttctacaccatgaaagccgcacttaatctgaaataa

DBGET integrated database retrieval system