KEGG   Klebsiella oxytoca KONIH1: KONIH1_11815Help
Entry
KONIH1_11815      CDS       T03269                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
kok  Klebsiella oxytoca KONIH1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N ThiF
Motif
Other DBs
NCBI-ProteinID: AID89727
LinkDB All DBs
Position
2502981..2504024
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILKTPGTMKIIAADIPVPKEHEVLIKIEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGKSVSKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTLEGALVEPAAVGMHAAMLANVKPGKKIVILGAGCI
GLMTLQACLCLGATDIAVVDVLEKRLAMAEQLGAKVVINGAKEDTVGRCQQFSGDMGADV
VFETAGSAITVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVSIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDFEDVQRAFDESVNNKREIIKGVIKVNH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatattaaaaacaccgggcacgatgaaaattatcgctgccgat
atcccggtacccaaagaacatgaagtgctgatcaaaattgaatacgtcggaatttgtggt
tcagatgtccacggttttgagtcggggccctttattccgccgaaagaccctaatcaggaa
attggtctgggacacgaatgcgccggtacggtggtggccgtaggcaaaagcgtgagcaaa
tttaagccgggcgaccgggtgaatattgaacccggcgtgccgtgcggccactgtcgctac
tgcctggagggaaaatacaatatctgtcccgacgtcgactttatggccacgcagccaaat
tatcgcggtgcgctaacccactatctatgccatccggagagcttcacttacaaactgccc
gataacatggacacccttgaaggcgctttggtggagcctgcggcggttggcatgcatgcc
gcaatgctggcgaacgtcaagccgggcaagaaaatcgtcatacttggcgcaggctgtatt
ggcttaatgaccctgcaggcatgcctttgcctgggggcaaccgacatcgcggtggttgat
gtgctggaaaaacgccttgccatggccgaacagctcggagccaaagtcgttatcaacggc
gcgaaagaggacaccgttgggcgctgccagcagttctccggcgatatgggggccgatgtt
gtttttgaaacggccgggtcggccatcaccgttaagcaggctccttacctggtgatgcgc
ggaggaaaaatcatgatcgtcggtacggttcccggtgattcagccatcaatttcctcaaa
attaaccgtgaggtctcgattcagaccgtcttccgctatgccaaccgctatccggtcacc
atagaagcgatctcctccgggcgtttcgatgtgaaatcgatggtgacgcatatttatgat
tttgaggatgttcagcgcgcgtttgatgaatccgttaataacaaacgcgagattattaaa
ggcgttattaaagttaaccattaa

DBGET integrated database retrieval system