KEGG   Klebsiella oxytoca KONIH1: KONIH1_16255Help
Entry
KONIH1_16255      CDS       T03269                                 

Definition
(GenBank) glycosidase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00500  Starch and sucrose metabolism
kok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kok00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KONIH1_16255
Enzymes [BR:kok01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     KONIH1_16255
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     KONIH1_16255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AID90569
LinkDB All DBs
Position
3414429..3416054
Genome map
AA seq 541 aa AA seqDB search
MADWHTRAIIYQIDSALFYDLNGDGCGDIAGIAAKLRYIRRLGATVIWITPFYLTPFLDE
GYDVSDHLQVDPRFGQLADIIAFIEQARELGMQVIIELLIQHTSDAHPWFQQARRSRRSP
FRDYYLWADSDDDNTPPMFPGVEESIWSWDDEAGQYFRHMFYRHEPDLNLASPAVIKEVE
NIVIFWLKLGVSGFRLDAASHLTKQAGRGEEKRGLWLLEHLRRLVEQHNPQAILLGEVDV
EVAQYRDYFGDNNRLNMVLNFWLNKYFYVSLASQSARPLIDAIKKMVVPPDACCFANWLR
NHDELDLEGIGNKNKQTVLDAFAPDKEMNVYQRGIRRRLAPMLNSDRRRLAFCHAVLFSL
PGVPIMRYGDEIGMGDDLALEERYAVRTPMQWAGSAGGGFSAADPQTFVAPMIDRGPFRY
QKVNVADSLLHRHSLLHRIIDIANTRSEFPEIAVAPFRIISTDRQAILGICYDDRERSVI
AFLNFSDKPLRFTAKGIYAAVWTPCLADKTYADALTPGKHAKLEISAYGYRWFWTNSSAL
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggctgactggcatacgcgggccattatctatcagattgattcagcactgttttacgat
cttaacggcgatggctgcggcgatatcgccgggatcgcggcgaagctgcgctatattcgc
cgactgggcgcgacggtgatctggataacgcccttctacctgacgccgtttctggatgag
ggttacgatgtcagcgaccatctgcaggtcgatccgcgatttggtcaactggcggatatc
attgcttttatcgagcaggcccgcgaattaggcatgcaggttattattgaattgctgatc
cagcacacctccgacgctcacccctggtttcaacaagcgcggcgcagccgtcgctcgccg
ttccgcgactattatctgtgggcagatagcgatgatgacaatacgccgcccatgtttccc
ggcgtcgaagagagcatctggtcgtgggatgacgaagccgggcaatattttcgccatatg
ttttaccgccatgaacccgatctcaatctggcctctcccgcggtgatcaaagaggtcgaa
aatatcgttatcttttggctgaagctgggggtttccggctttcgtctggatgccgcctcg
catttgacgaaacaggccggacgcggcgaggagaaacgcgggctatggctcctggaacat
ctgcgtcggctggttgaacaacataatccgcaggccatactgctcggcgaagtcgacgtt
gaggtggcgcagtatcgcgactattttggcgataataaccgacttaatatggtacttaac
ttctggttgaacaaatatttttacgtcagcctcgccagccagagcgcccgcccgctgatc
gacgccatcaagaaaatggtagtgcctcctgacgcctgctgcttcgcaaactggctgcgc
aaccacgatgaactggatcttgaagggatcggtaacaagaacaagcagaccgtgctggat
gccttcgcgccggataaggagatgaacgtttatcagcgcggtattcgccgtcggctggcg
cccatgctgaacagcgaccggcggcggctggcgttctgtcatgccgtgcttttttcgctg
cccggcgtaccgatcatgcgctacggggatgagatcggcatgggtgacgacctggcgctg
gaagagcgctacgcggtgcgtacgccgatgcagtgggccggttcagcgggcggcggcttc
tccgcagccgatccgcagacgtttgtggctcccatgatcgaccgggggccgtttcgctat
cagaaagtcaacgtcgctgattccctgctgcaccgccattctctcctgcaccgtattatt
gatatcgccaatacgcggtcagaattcccggaaatcgccgttgcgcctttccgcatcatt
agcaccgatcggcaggcgattctcgggatctgctacgatgaccgcgagcgcagcgtcatc
gcctttcttaatttcagtgataaaccgctgcgttttaccgcgaaagggatctatgcggcg
gtgtggacgccctgcctggccgacaaaacctacgcggacgcgctcactcccggtaagcac
gctaagctggagattagcgcatatggctatcgatggttctggaccaacagtagcgcgctg
cgttag

DBGET integrated database retrieval system