KEGG   Klebsiella oxytoca KONIH1: KONIH1_18775Help
Entry
KONIH1_18775      CDS       T03269                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00500  Starch and sucrose metabolism
kok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KONIH1_18775
Enzymes [BR:kok01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     KONIH1_18775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C Malt_amylase_C UPF0016 DUF1939
Motif
Other DBs
NCBI-ProteinID: AID91046
LinkDB All DBs
Position
3923700..3925187
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPTGGELWREVEALAPNLNEIGINMIWLPPAYKGASGGYSVGYDCYD
LFDLGEFDQKGSVATKYGDKTQLLAAISALRQHDIAVLLDVVVNHKMGADEKEPVRIQRV
DQNDRTQIAEEIVECEAWTRYTFPVRAGKYSEFIWDYKCFSGIDHIENPDEDGVFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNRAVTEEIKYWARWVMEQTGCDGFRLDAVKHI
PAWFYKEWIDHVQEVATKPLFIVAEYWSHEVDKLQQYIDMVDGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFSGTLVEADPFHAVTLVTNHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYADLFGASYEDTGDDGETYAVEMPVIEQLHELIDARQRFAHGVQTLWFDHPNCI
AFSRSGTEEDPGCVVVLSNGDDGEKTLPLGENYRNKRWRDFLGNREEVIETDDEGNGVFT
CNGGSVSVWVIEEVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccacgttactgcagtgctttcactggtactaccccaccggcggcgaatta
tggcgtgaagtcgaagccctggcgccaaacctcaacgaaatcggcattaacatgatttgg
ttgcctcctgcctacaaaggcgcctccggcggctactctgtcggttatgattgctacgat
ctgtttgacctcggcgaattcgaccagaaggggtctgtcgccacgaaatatggcgataaa
acccagctactggccgccatatccgccctgcgccagcacgatatcgccgtactccttgac
gtcgtggtcaaccataaaatgggcgcggatgaaaaagagccggtacgtattcagcgtgtt
gatcaaaacgaccgcacgcaaatcgccgaggagattgtggaatgtgaagcctggacgcgc
tacaccttcccggtacgcgccggcaaatactctgaattcatctgggattataagtgcttt
agcggcatcgaccatattgagaatcctgatgaagatggcgtgtttaaaatcgtcaacgac
tataccggcgaaggatggaacgatcaggttgatgatgaaatgggtaacttcgactacctg
atgggtgaaaatatcgattttcgcaatcgagcggtgacagaggagattaagtactgggcc
cgctgggtgatggaacaaaccggctgcgatggcttccgcctcgatgcggttaaacatatc
cccgcctggttttataaagagtggatcgaccacgtccaggaggtggcgacaaagccgctg
tttattgtggcggaatactggtcgcatgaagtcgataagctccagcagtatatcgacatg
gttgacggtaagacgatgctctttgacgcgccgctgcagatgaaattccatgaagcctcg
cggcagggacgcgactatgacatgagccagatttttagcggtacgctggtggaagccgac
ccgttccacgccgtaaccctggtgaccaaccatgatacccagccgctgcaggcgctggag
gcgccggttgaggcctggttcaaaccgctggcttatgcactcattttgttacgtgaaaac
ggcgttccgtccgtcttttatgccgacctgttcggcgccagctacgaagataccggcgac
gacggcgagacctacgccgttgagatgccggttattgagcagttacacgaactgatcgat
gcccgtcagcgttttgctcacggcgtacaaacgctgtggttcgatcatccgaactgtatc
gctttcagccgcagcggcaccgaagaggatccgggctgcgtggtggtgctttccaacggt
gacgacggagaaaaaacgcttcctctgggggaaaactaccgtaataaacgctggcgcgat
tttctcggcaaccgcgaggaagtgattgaaaccgacgatgaaggaaacggggtttttacc
tgtaacggcggcagcgtcagcgtctgggtcatcgaagaggtgctataa

DBGET integrated database retrieval system