KEGG   Klebsiella oxytoca KONIH1: KONIH1_20380Help
Entry
KONIH1_20380      CDS       T03269                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00564  Glycerophospholipid metabolism
kok01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kok00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KONIH1_20380
Enzymes [BR:kok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KONIH1_20380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_oxidored DAO_C FAD_binding_3 Pyr_redox_2 Thi4 SO_alpha_A3 3HCDH_N GMC_oxred_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AID91349
LinkDB All DBs
Position
4285472..4287094
Genome map
AA seq 540 aa AA seqDB search
MADSREYDVIIIGGGATGAGIARDCALRGLKAALVERYDIATGATGRNHGLLHSGARYAV
TDSESARECISENRILRRIARHCIEPTSGLFITLPEDDPAYQHTFITACQQAGIEAQPLT
PAEALRIEPAVNPALLGAVQVPDGTVDPFRLTAANMLDAREHGAAILTGCEVTGLLRQGD
RVHGVTIYNHQLRESRTLRAQVVVNAAGIWGQRIAEYADLRIAMFPAKGSLLILDHRINR
QVINRCRKPADADILVPGDTISLIGTTSMHIPYDEIDDNRVTAEEVETLLREGEKLAPIM
GRTRVLRAYSGIRPLVASDDDPSGRSVSRGIVLLDHARRDGLEGFITITGGKLMTYRLMA
EWATDALCRKLGNTVPCTTADTPLPGSQEPAEATLRKIISLPASLRGSAIYRHGDRTPAW
LGDSRQHRSLVCECEAVTAGEVQYAVENLAVKNLLDLRRRTRVGMGTCQGELCACRAAGL
LARFNVTTSARSLTQLSQFLNERWKGVQPVAWGDALRESEFTRWVYLGLCGLQKEYQDEV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggccgatagtcgtgaatatgacgtcattattattggcggcggcgccaccggcgccggg
atcgcgcgcgactgcgcgctgcgcgggctgaaggcggcgctggttgagcgctacgatatc
gccaccggggcgaccggccgcaaccacggcctgctgcacagcggcgcgcgctatgcggta
accgatagcgaatcggcgcgggagtgtatcagcgaaaaccgcatcttacgccgcatcgcc
cggcactgcattgagcccaccagcggcctgtttattaccttgccggaagacgatccggcg
tatcagcacacctttatcaccgcctgccagcaggcgggtattgaggcccagcctctgacg
cccgccgaggcgctgcgcattgagcccgcggttaacccggcgctgctcggcgcggtgcag
gtccccgacggcaccgtcgatcctttccgcctcaccgccgcaaatatgctcgatgcccgc
gaacatggcgccgctatcctcaccggctgcgaagtcaccggcctgctgcgtcagggcgat
cgcgtccatggcgtcacgatctacaaccatcagctccgtgaatcgcgcacgctgcgcgct
caggtggtggtcaacgccgccgggatctgggggcagcgcatcgcagagtatgccgacctg
cgcatcgcgatgtttccggcaaaaggatcgctgttaatcctcgatcaccgcattaaccgt
caggttatcaaccgctgccgcaaaccggctgacgccgatatcctggtgcccggcgatact
atttcgctgattggcactacttcgatgcatattccctatgacgaaattgacgacaaccgg
gtaacggccgaggaggtcgaaacgctgctgcgcgaaggggaaaagctggcgccgatcatg
gggcggacgcgggtactgcgcgcctactccggcatacgtccgctggtcgccagcgatgac
gatcccagcgggcgcagcgtcagtcgcggtattgtgctgctcgaccacgcccggcgcgac
ggactggagggctttatcaccatcaccggcggtaagctgatgacctatcgtctgatggcg
gagtgggccacggatgcgctctgccgcaagctcggaaataccgtcccctgtacgaccgcc
gatacgccactgccgggctcgcaggagccggcggaagccacgctacgcaaaatcatctct
ttacctgcgtcgctgcgcgggtcggccatctatcgccacggcgatcgcactccggcctgg
cttggcgatagccgccagcaccgcagcctggtctgcgaatgcgaggcggtgaccgccggc
gaggttcagtacgcggtcgaaaacctggcggtgaaaaacctgctcgacctgcgccgccgc
acccgcgtcggcatgggaacctgtcagggcgaactgtgcgcctgccgcgccgccgggctg
ctcgcgcgttttaacgtcaccacttccgctcgatcccttacccagctgtctcaatttttg
aacgaacgctggaaaggcgtccagccggtggcctggggggacgcgctgcgcgaaagcgag
ttcacccgctgggtctatctcggcctgtgcggattacaaaaggagtatcaggatgaagtt
tga

DBGET integrated database retrieval system