KEGG   Klebsiella oxytoca KONIH1: KONIH1_20865Help
Entry
KONIH1_20865      CDS       T03269                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00071  Fatty acid degradation
kok00280  Valine, leucine and isoleucine degradation
kok00281  Geraniol degradation
kok00310  Lysine degradation
kok00362  Benzoate degradation
kok00380  Tryptophan metabolism
kok00410  beta-Alanine metabolism
kok00640  Propanoate metabolism
kok00650  Butanoate metabolism
kok00903  Limonene and pinene degradation
kok00930  Caprolactam degradation
kok01100  Metabolic pathways
kok01110  Biosynthesis of secondary metabolites
kok01120  Microbial metabolism in diverse environments
kok01130  Biosynthesis of antibiotics
kok01200  Carbon metabolism
kok01212  Fatty acid metabolism
Module
kok_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KONIH1_20865 (fadJ)
   00650 Butanoate metabolism
    KONIH1_20865 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KONIH1_20865 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KONIH1_20865 (fadJ)
   00310 Lysine degradation
    KONIH1_20865 (fadJ)
   00380 Tryptophan metabolism
    KONIH1_20865 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KONIH1_20865 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KONIH1_20865 (fadJ)
   00281 Geraniol degradation
    KONIH1_20865 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KONIH1_20865 (fadJ)
   00930 Caprolactam degradation
    KONIH1_20865 (fadJ)
Enzymes [BR:kok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KONIH1_20865 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KONIH1_20865 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KONIH1_20865 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AID91445
LinkDB All DBs
Position
complement(4384739..4386883)
Genome map
AA seq 714 aa AA seqDB search
METVSAFTLEVRPDNIAVITIDAPGEKMNTLKAEFASEVRGIIRQIRDNKELRGAVFISA
KADNFIAGADINMIARCHSAQEAEALARQGQQIMAEIHGLSIPVIAAIHGACLGGGLELA
LACHGRVCSDDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGVSGALEMILTGKQLRPRQAL
KAGLVDEVVPQTILLQTAIELALKGRPASRAVPARERILAGPLGRSLLFRLVAKKTHHKT
QGNYPATERILQVIETGLAQGCSSGYAEEARAFGELAMTPQSQALRSIFFASTDLKKDRG
ADADPVALRSVGILGGGLMGGGIAYVTACKGGLPVRIKDIQPRGINHALKYSWDLLDKQV
RRRYLRASERDRQMGLISGSLDYQGFAHRDVVIEAVFEDLTLKQKMVSEVEQHCRPETIF
ASNTSSLPIGEIAAHASRPQRVIGLHFFSPVDKMPLVEVIPHSGTDRQTIATAVKLAKLQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLMEGEPVEHIDNALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAWGERFSPPANIISSILNDDRKGRKNNRGFYLYAAKGRKSKKRPDPA
IYALLGISSPQARLSAQQVAERCVMMMLNEAARCFDERVVRSARDGDIGAVFGIGFPPFL
GGPFRYMDTLGAGEVAAILQRLAAQYGPRFTPCDTLLHMAEQGATFWPAEERTT
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccgtatcggcatttacgcttgaggttcgcccggacaatatcgccgtcatcacc
attgacgcgcccggtgaaaaaatgaataccctgaaagctgagttcgccagcgaggtacgg
gggatcatccgccagatccgcgacaataaggagctgcgcggcgcggtgttcatctcggca
aaagcggataactttatcgccggggcggatatcaatatgattgcccgctgccattccgcg
caggaagcggaggcgcttgcccgtcagggccagcaaatcatggccgagatccacggtctg
tcgattccggtgattgccgctatccacggcgcatgcttgggcggcggccttgagctggcg
ctggcctgccacgggcgggtatgcagcgatgacgataaaacccggcttggcctcccggaa
gttcagctggggctgctgcccggctctggcggaactcagcgtctaccgcgattaattggc
gtcagcggcgcgctggagatgatcctgaccggtaagcagcttcgcccgcgtcaggccctg
aaggcagggctggttgatgaggtggtgccgcagactatcctgctgcaaaccgcgattgaa
ctggcgctcaaaggtcgcccggcaagccgcgctgttccggcgcgcgaacgtattctcgca
ggcccgcttggccgcagcctgctgtttcgtctggtcgcgaaaaagacgcatcacaaaacc
caggggaactacccggcaactgagcgcattctgcaggtgattgaaaccggactggcgcag
ggctgcagcagcggatacgccgaggaggcccgcgcttttggcgagctggcgatgacgccg
caatcgcaggcgctacggtcgatttttttcgccagcaccgatctgaaaaaagatcgcggc
gcggatgctgatcccgtcgcgctgcgcagcgtgggcattctgggcggaggactcatgggg
ggcggtatcgcttacgtcaccgcctgcaaaggcggattaccggtacgcataaaagacatc
cagccgcgcgggataaatcacgcactgaagtacagctgggatctgctcgataaacaggtg
cgtcgccgctatctgcgcgccagcgagcgcgatcgccagatggggttaatatccggttcg
ctggattatcagggatttgcacatcgcgatgtggtgatcgaagcggtgtttgaagacctt
acgctcaagcagaagatggtcagcgaagttgaacagcactgccgcccggagacgatcttt
gcttctaacacctcgtctttaccgatcggcgagatcgcggcgcatgcaagcaggccgcag
cgggtcatcgggcttcacttctttagcccggtagacaaaatgccgctggtggaggtgatt
ccacatagtggtacggatcggcaaacaattgcgacggcggttaagctggcgaaattgcaa
ggtaaaacgccgattgtcgtcgccgataaagcgggcttttatgttaaccgcattctggcc
ccctacataaatgaagccatgcgcctgttgatggaaggcgagccggtagagcatattgat
aacgctttggttaaattcggttttccggttggccctattcagctccttgatgaagtggga
atcgataccggtaccaaaattatcccggtgctggaggccgcatggggagaacgttttagc
ccgcctgcaaacatcattagttcgattctgaatgacgatcgcaaagggagaaaaaataac
cggggtttctatctttatgcggcaaaagggcgtaaaagcaaaaaacggcccgatcctgca
atctacgctttactgggtatttcctcaccgcaggcgcgcttgtccgcgcagcaggtggcg
gaacgctgcgtgatgatgatgcttaacgaagcggcgcgctgcttcgatgagcgagtggtt
cgcagcgcccgcgatggtgatatcggcgccgtatttggcattggttttccgccgtttctt
ggcggcccgttccgctatatggataccctgggagcgggggaggtcgccgcgatattacag
cgcctggctgctcagtacggcccgcgttttacaccatgtgacactttgttacacatggcc
gagcagggggcgaccttttggcccgctgaggaacgtacgacctaa

DBGET integrated database retrieval system