KEGG   Klebsiella oxytoca KONIH1: KONIH1_27230Help
Entry
KONIH1_27230      CDS       T03269                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00564  Glycerophospholipid metabolism
kok01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kok00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KONIH1_27230 (glpD)
Enzymes [BR:kok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KONIH1_27230 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored FAD_binding_2 3HCDH_N NAD_binding_8 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AID92659
LinkDB All DBs
Position
5671111..5672619
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEASDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGTESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVRTRTRAISAKRENG
LWIVEAEDIDSGEKFTWQARGLVNATGPWVKQFFDEGMHLRSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVAIDDNEVNYLLNVYNAHF
KKPLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDDNGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYKGIGPAWTKTAVLPGGDIGSDRDDYAAKLRRRFSFISESMARHYART
YGSNSELILDKATSLDDLGEHFGHEFFEAELRYLVEHEWVRSLDDAIWRRTKQGMWLNDE
QQARISEWLAQHAGKSELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgattgtgatagggggaggcatcaacggtgccggtatcgcggca
gacgccgcagggcgtggtttatccgtactgatgctggaagcaagcgaccttgcctgcgcc
acatccagcgccagctcaaagctgattcacggcgggctgcgctaccttgaacactatgag
ttccgcctggtgagcgaagcgctggccgaacgcgaagtgttgttgaaaatggccccgcat
atcgccttcccgatgcgctttcgtttaccgcatcgcccgcacctgcgtccggcgtggatg
atccgcattggcctgtttatgtacgatcatctgggcaagcgcaccagcttacccggctca
accgggttgcgttttggcacagaatcggtacttaaacctgaaatcgtgcgcggtttcgaa
tattccgactgctgggttgacgatgcgcgtctggtgctggccaatgcccagatggttgtg
cgtaaaggcggggaagtgcgcacgcggacccgcgccatctcggcaaaacgtgaaaacggt
ttgtggattgtcgaagccgaagatattgatagcggcgagaagtttacctggcaggcgcgc
ggtctggttaacgccaccggcccgtgggtcaaacagttcttcgacgaagggatgcatctg
cgctcgccgtacggtattcgcttgatcaagggcagccatatcgtggtgccgcgcgtgcac
acgcagaaacaggcctacatcctgcaaaatgaagataaacgcattgtgtttgtgatcccg
tggatggatgaattttccatcatcggcaccaccgacgtggagtataaaggcgatccgaaa
gcggtagcgatcgacgacaacgaagtgaactacctgctgaacgtctataacgcccacttt
aaaaagcctctcacgcgggacgatatcgtctggacctactccggcgtgcgcccgctgtgc
gacgatgaatccgactcgccgcaggcgatcacccgcgattacactcttgatatccatgat
gataacgggcaggcgccgctgctgtcggtctttggcggcaagctgaccacctatcgcaag
ctggccgagcatgcgctggagaaactgacgccttactacaaaggcatcggcccggcatgg
accaaaaccgcggtgctgcccggcggcgatatcggcagcgaccgtgacgactacgcggcg
aaactgcgccgccgcttttcgtttatcagcgaatcgatggcccgccattacgcccgcacc
tacggcagcaacagcgagctaatccttgataaggcgacctcactggacgatctgggtgag
catttcggccatgagttttttgaagccgaactgcgctatctggttgagcacgaatgggtt
cgttcgctggatgacgcgatctggcgtcgcactaaacaaggtatgtggctgaatgacgag
cagcaggcgcgcatcagcgagtggctggcgcagcacgcgggaaagtctgagctgtcgctg
gcgtcgtaa

DBGET integrated database retrieval system