KEGG   Kosmotoga olearia: Kole_0242Help
Entry
Kole_0242         CDS       T00914                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
kol  Kosmotoga olearia
Pathway
kol00500  Starch and sucrose metabolism
kol01100  Metabolic pathways
kol01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Kole_0242
Enzymes [BR:kol01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Kole_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ACR78967
UniProt: C5CIX8
LinkDB All DBs
Position
complement(268540..271104)
Genome map
AA seq 854 aa AA seqDB search
MYFLEKITVVPKLPEKLKRLEELAYNLWWTWNPKVEALFRSMDSELWYEVKRSPVKLIRR
INQQKLNELAKNEKFLKEYAEVVAEFDAYMNNSNTWMDKNHPDRKNELVAYFCAEYGLHE
SFPIYSGGLGILAGDHLKTASDLGLNIVGVGLLYRHGYFVQTIDKTGWQHSEFPSYDFSD
FPVVSATNEKGEEIYVNIEFPGRKVWAKVWKAMVGRSVLLLLDTDVPMNDPEDRKITAQL
YGGNRETRIQQELVLGIGGVRALRMLGYNPKVWHMNEGHAAFLALERIREYVQGKKLDFR
TAIELTRATNIFTTHTPVPAGNDVFDLSLIDKYFSEFWPKLNASRQEFIDLGLERGVGGH
QQFSMTVLALRLSSLANGVSKLHGEVSRKLWSHVFPEYPAVEVPITHVTNGVHMWTWLNR
DLKKLFDKYFPKGWEEKITDSEIWEYVDKVPDEELWEVHMKLKERMKVFLQGRIRRQRLR
CGETIEELMEVDKLLPEKILTIGFARRFATYKRATLILKDIERLKMILTDNERPVQFVFA
GKAHPADEPGKELIRQLYQLSRMPEFKNRIIILENYDMNIARHMISGVDVWMNNPRRPHE
ASGTSGQKAAMNGVINFSVMDGWWVEGYNGENGWTIGDNRDYDDNELQDRIDSVSIYSTL
EKEIIPLYYKRDENGIPREWVKKMKNSIKSVALNFNSHRMLIDYIENLYLKGVEYYEFMN
ADSFKKALEIARWHQRLLQNWGYIRIKPNLLRPSSGDSLRVGSEISLTANVYLGELKPEE
VRVEIYVAMLNEDGEIVKFKTYPMKLEKEDVHGEYVYTGKFTVEEEGKMVYTIRVIPNPE
NLPNGHFLPMAKWI
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgtacttcctggaaaaaatcactgtggttccaaagcttcccgagaaattgaaacgtctc
gaggaacttgcttacaatctatggtggacgtggaacccgaaagtagaagctcttttccgt
tcgatggattcagaactctggtacgaggtaaagagaagtccagtaaaactcataaggcga
attaaccagcagaaactcaacgagcttgcaaagaacgaaaagtttctaaaagaatatgcc
gaagttgttgcagaattcgatgcgtatatgaacaacagcaatacatggatggacaaaaat
caccccgacagaaaaaacgagcttgtagcgtatttttgtgctgaatacggccttcacgaa
tctttccctatctattctggggggctggggatccttgcaggagaccacctgaaaaccgcc
agcgatcttggacttaacatcgttggggttggtttgttgtatcgtcatggttactttgtg
caaaccatagacaaaacaggctggcagcattctgaatttcccagttatgatttttccgac
tttccggtagtatccgcaacgaatgaaaaaggtgaagagatttatgtaaacattgaattt
cccggaagaaaggtctgggcaaaggtctggaaagcgatggttgggcgttcagtccttctg
cttcttgatacggatgttcccatgaacgatcccgaagacagaaagattacagcccagctt
tacggcggaaatcgcgagacgcgaattcagcaggaactcgtcctcggaattggtggtgtc
agggctctcaggatgctcggttacaatccgaaggtatggcacatgaacgaagggcatgct
gcctttcttgcattggaaaggatcagagagtatgttcagggcaaaaagctcgactttaga
acagccatagaattgacccgcgccaccaacattttcacaacgcatacacctgtccccgcc
ggtaacgatgtctttgacctgagcctcatagacaaatacttctcagaattctggccaaaa
ctgaatgcttcaagacaggaattcatagaccttggtctcgaaagaggtgttgggggccat
cagcaattcagcatgaccgttcttgccctgagattatcaagtctggcaaacggtgtcagc
aaactccacggagaggtttccagaaaattgtggagccatgtatttccggagtatcctgcc
gttgaagtgcccataactcacgtgacgaatggtgttcacatgtggacgtggttgaaccgc
gacctcaagaaactcttcgataagtatttcccgaaaggctgggaagagaagataacggat
tctgagatatgggaatatgtcgataaggttcctgacgaagaactctgggaagttcatatg
aaactaaaggaaagaatgaaagtattccttcagggccgtataagacgacagcgtttgagg
tgcggagaaacaatagaagaactgatggaagtcgataaactcctacctgaaaagattctt
acgataggcttcgcaaggagattcgccacatataagagagctaccctcattttgaaagat
atcgaaagattaaagatgatactcacagataacgaacgcccggtacaatttgtctttgca
ggtaaagcccatccagctgatgagcccgggaaagaactcatacgtcagttataccagttg
tcaaggatgccggaattcaagaatagaataatcatactcgaaaactacgatatgaatatt
gcccgtcatatgatttctggcgtcgatgtctggatgaacaacccccgaagacctcacgaa
gcaagcggtaccagtggccagaaagctgctatgaatggcgtcataaatttcagtgttatg
gatggatggtgggtcgaaggttacaacggcgaaaacggctggacaattggggataacaga
gattacgacgataacgaacttcaggaccgtatagacagcgtttctatctatagtaccctc
gaaaaggaaatcatcccgctttattacaaaagagatgaaaatggtattcctcgagagtgg
gtcaagaaaatgaaaaactccataaagtccgtagccctcaattttaacagccacaggatg
cttatagactacatagaaaatctctacctaaagggtgtcgaatactatgaattcatgaac
gctgattctttcaaaaaggccttagagatagcaagatggcaccaacggctccttcaaaac
tggggctacataagaataaaaccaaatcttctcaggcccagctcaggggacagtttgaga
gttggaagcgaaatttcgctgacagccaacgtgtatcttggggaattgaaaccggaagaa
gttcgggtggaaatatatgttgccatgctgaacgaagatggagaaatagtcaaattcaaa
acctacccgatgaaactcgaaaaagaggatgtccatggtgaatatgtttatacgggcaag
ttcacagtggaagaagagggtaaaatggtctacaccatcagggtaatacccaaccctgaa
aatcttcctaatggtcatttcttaccaatggctaaatggatatag

DBGET integrated database retrieval system