KEGG   Kosmotoga olearia: Kole_1625Help
Entry
Kole_1625         CDS       T00914                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
kol  Kosmotoga olearia
Pathway
kol00010  Glycolysis / Gluconeogenesis
kol00230  Purine metabolism
kol00620  Pyruvate metabolism
kol01100  Metabolic pathways
kol01110  Biosynthesis of secondary metabolites
kol01120  Microbial metabolism in diverse environments
kol01130  Biosynthesis of antibiotics
kol01200  Carbon metabolism
kol01230  Biosynthesis of amino acids
Module
kol_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kol_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_1625
   00620 Pyruvate metabolism
    Kole_1625
  Nucleotide metabolism
   00230 Purine metabolism
    Kole_1625
Enzymes [BR:kol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Kole_1625
Membrane trafficking [BR:kol04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Kole_1625
Exosome [BR:kol04147]
 Exosomal proteins
  Proteins found in most exosomes
   Kole_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH DUF3006
Motif
Other DBs
NCBI-ProteinID: ACR80315
UniProt: B5M6L6
LinkDB All DBs
Position
1743675..1745093
Genome map
AA seq 472 aa AA seqDB search
MRKTKIVCTVGPATENPDMLKKLIEAGMNVVRLNTSHDDLEHHRRRIRTVKKIREELAVP
ITILLDLAGPKIRTGDFSSDTVVLKKGDLFTLTTEDIVGDDKRVSVSYKKLPSEVNSGDF
ILVNDGKIKLKVVETNETEIKTTVVNGGEITHRRGINVPGIDLGIEALTLKDKEFIKLGI
EEGVDYFALSFVRKPEDVIEAKKIISSFGGSIPIISKIETVQALKRIESIAEVSDGLMVA
RGDLGVEIPVEEVPIAQKKIIRAGNKNRIPVITATQMLESMIENPVPTRAETTDISNAII
DGTDAVMLSAETSVGKYPIEAVSVMHKTALSTEKYIRAHPYLLQWTREDVVTDDHTDAIC
RAAWDISETLKIKLIVSSTYTGHTAINVSGFRPRSHILAVTPNKNTYHRLGMVWGVTPML
LELGSTIDEMVKIASEKARKLDLLDPGDNFIITAGVPLGKANTTNMLKLERA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagacgaaaatagtttgtactgttgggccggcaacagaaaatcccgatatgtta
aaaaaactcatagaagctggcatgaatgtggtgagattaaacacttcgcatgatgattta
gaacatcatcgtcggagaattagaacagttaagaaaattcgtgaagaacttgctgtgcct
atcactatattacttgaccttgccggcccaaagataaggacgggagacttttcttcagat
acggttgttcttaagaaaggagacctattcactctcacgacagaggatattgttggtgat
gataagcgagtgagtgtaagttacaaaaaactaccatctgaagttaattctggagacttc
atcctcgtaaacgacggaaaaataaagttgaaggttgtagaaacgaacgagacagagata
aaaaccaccgtcgttaacggtggggaaataacgcaccgtagaggaataaacgttcctgga
atcgatcttggaatagaagctcttactttaaaggataaggaatttataaagttgggcatc
gaagaaggcgtagactactttgcactgtcttttgtcaggaaacccgaggatgttatcgaa
gctaagaagatcatttcaagctttggtggcagcattccgataatttcgaaaatagaaaca
gtgcaggctctaaaaagaatagagtctatcgctgaggtctcagatggtcttatggtagct
cggggtgatcttggtgtcgaaattcctgtggaagaagttccaatagctcaaaaaaagata
atacgcgcaggaaataaaaatagaatcccggtaataacagctactcaaatgcttgaatca
atgatagaaaaccctgttcctacaagagcagagaccacggacatctccaatgcaataatc
gatggaaccgatgcggtgatgctctcagccgaaacctctgttggcaaatatcctatcgaa
gcagtgagtgtaatgcataaaaccgcattgtccacagaaaagtatattcgtgcccacccc
tatcttctccaatggactcgcgaagatgttgtcaccgacgaccatacggacgctatatgc
cgcgcggcgtgggatataagcgaaacattaaaaataaagcttatcgtttcgtctacctat
acagggcacacggcaataaacgtttccggtttcagaccacgttcgcacattctggcagtt
accccaaacaagaatacgtaccaccgccttggaatggtctggggtgtaacacccatgcta
ttagagctcggttcaacgatagacgaaatggtgaagattgccagtgaaaaggccagaaag
ctcgaccttcttgatccgggagataatttcataatcactgctggtgttccacttggcaag
gctaacactaccaatatgttgaaactcgaaagagcttaa

DBGET integrated database retrieval system