KEGG   Klebsiella michiganensis M1: HR38_12290
Entry
HR38_12290        CDS       T03349                                 

Definition
(GenBank) PTS mannose transporter subunit IIC
  KO
K11196  fructose PTS system EIIC component
Organism
kom  Klebsiella michiganensis M1
Pathway
kom00051  Fructose and mannose metabolism
kom02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:kom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HR38_12290
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HR38_12290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kom02000]
    HR38_12290
Transporters [BR:kom02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    HR38_12290
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: AIE69201
UniProt: A0A249WDE4
LinkDB
Position
2604885..2605685
AA seq 266 aa
MTTIQIILLLVIAAITGMGSVLDEGQTHRPLVACTLVGWVLGDMTTGIILGGTLEMMALG
WMNVGLAMAPDTAIASVISTILVINTNQGIGEGIAIAVALAAAGQALTIFVRTMTVFLIH
RADTYAEKGNMRGIEIMHITALGFQALRVMIPTFVVVMMSVDSVQAMLNGIPPVVTHGLQ
IGGGIIVVVGYAMVINMMSVKYLMPFFFAGFLIAAFTSFNLVGLGGMGLVGALLYIQLSP
KYQPKTLTAVADGGPASLNNNDDLDA
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaccactatacaaattatattgctgctggtgattgcagccattaccgggatgggtagc
gtgctggatgaagggcaaacgcatcgtccacttgttgcctgtacgctggttggctgggta
cttggcgatatgactaccggtatcattcttggcggtacgctggaaatgatggccctcggg
tggatgaacgttgggctggcgatggcgccggataccgccatcgcctcggtgatatcgacc
attctggtgattaatacaaatcaggggattggcgaaggcatcgcgattgccgtcgcgtta
gccgctgcgggtcaggcgctgacgatttttgtcagaacgatgacggtgttcttgatccac
cgggcggatacctatgctgaaaagggcaatatgcgcggtatcgaaatcatgcatatcact
gcgcttggtttccaggcgctgcgcgtgatgattcctacctttgtggtggtcatgatgagc
gttgattcggtgcaggccatgttgaacggtattccgccagtggtgacgcatggtctgcaa
attggcggcggtattattgttgttgtgggttatgccatggtcatcaatatgatgagcgtc
aaatatcttatgccgttcttttttgccggtttcttgattgcggcttttaccagtttcaac
ctcgttggtttagggggaatgggattagtcggtgcgttgctgtatatacagctgagtcca
aaataccagcctaaaaccctgaccgccgtggcggatggtgggccggcttctttaaataat
aacgacgatttggatgcataa

DBGET integrated database retrieval system