KEGG   Klebsiella michiganensis M1: HR38_12885Help
Entry
HR38_12885        CDS       T03349                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kom  Klebsiella michiganensis M1
Brite
KEGG Orthology (KO) [BR:kom00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HR38_12885
Enzymes [BR:kom01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HR38_12885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Thi4 DAO K_oxygenase NAD_binding_8 FAD_binding_3 FMO-like Glutaredoxin AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AIE69313
UniProt: A0A0J2I644
LinkDB All DBs
Position
2744173..2745738
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDGAKSAEIRELLAEIAELSDKVTFKEDNGLAV
RKPSFLITNPGSSQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQTLLEQIRNIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTYQNEITERNVMGVPAVFMNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEELNKREAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSEYDVDVIDSQSASRLIPATVEG
GLHQVETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVVGD
GSKVTGLQYRDRVSGDEHHVALSGIFVQIGLLPNTNWLEGAIERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcttatcttgagaagctgaccaaacct
gttgagctgattgccacgctggatgacggcgctaaatcggcagaaatcagggaactgctg
gctgaaattgctgaactgtcagataaagtcaccttcaaagaagataacggcctggcggtg
cgtaagccgtcattcctgattaccaaccccggctccagccaggggccgcgctttgccggc
tctccgctgggacatgaattcacctctttagttctggctctgctgtggaccggcggtcat
ccgtcaaaagaagcgcagactctgctggagcagatccgcaatatcgacggtgattttgaa
ttcgaaacctactattcgctttcatgccataactgcccggacgtggttcaggcgctgaac
ctgatggcggtactgaacccgcgcatcaagcacacggcgattgacggcggaacgtatcag
aatgaaatcaccgaacgcaacgtgatgggcgtaccggcggtatttatgaacggtaaggaa
tttggtcagggtcgcatgacgctgacggaaatcgttgccaaagtggatactggcgcggaa
aaacgcgcggcggaagagctgaataaacgtgaagcctatgatgtcttaatcgttggctcc
ggtccgtccggcgcagcggcagccgtttactccgcgcgtaaaggtattcgtaccggcctg
atgggtgaacgctttggcggccaggtgctggataccgttgatattgaaaactatatttca
gtacccaaaacggaaggccagaaactggctggcgcattaaaagcgcacgtcagcgaatac
gatgttgatgtgatcgattctcagagcgcctccagactgatcccggcgacggttgaaggc
ggcctgcatcaggttgagaccgcctccggcgcggtgctgaaagcgcgtagcgttatcatt
gccaccggcgcgaaatggcgtaacatgaacgtgccgggtgaggatcagtatcgtaccaag
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggtaaacgcgtggcggtt
atcggcggcggtaactccggtgtggaagcggcaatcgatctggcaggcgttgttgaacac
gttactctgctggagttcgcgccggaaatgaaggccgaccaggttctgcaggataaagtc
cgcagcctgaaaaacgtcgatatcattctcaacgcgcagaccacggaagtggtgggcgac
ggtagcaaagtcactggcctgcagtaccgcgaccgcgtgagcggcgatgagcatcacgtg
gcgctgtcggggatcttcgtgcagatcggtctgctgccgaataccaactggctggaaggc
gcgattgagcgcaaccgcatgggtgaaatcatcattgatgcgaaatgtgaaaccaacgtg
aagggcgttttcgctgccggcgactgcacgaccgttccgtacaaacagattattatcgcc
accggcgaaggtgcgaaggcgtctttgagctcgttcgattacctgattcgcactaagact
gcataa

DBGET integrated database retrieval system