KEGG   Klebsiella michiganensis M1: HR38_16770Help
Entry
HR38_16770        CDS       T03349                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
kom  Klebsiella michiganensis M1
Pathway
kom00061  Fatty acid biosynthesis
kom00780  Biotin metabolism
kom01100  Metabolic pathways
kom01130  Biosynthesis of antibiotics
kom01212  Fatty acid metabolism
Module
kom_M00083  Fatty acid biosynthesis, elongation
kom_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:kom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HR38_16770
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HR38_16770
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HR38_16770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kom01004]
    HR38_16770
Enzymes [BR:kom01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     HR38_16770
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     HR38_16770
Lipid biosynthesis proteins [BR:kom01004]
 Fatty acid synthase
  Component type
   HR38_16770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AIE70040
UniProt: H3MY49
LinkDB All DBs
Position
complement(3574920..3575708)
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILLTGLASKLSIAYGIAQAMHREGAELAFTYQNEKLKGRVEEFAAALGSNIV
LPCDVAEDESIESLFTELAKVWPKFDGFVHSIGFAPADQLDGDYVNAVTREGFKIAHDIS
AYSFVAMAKACRGMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTTEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctgttgactggccttgccagcaaactgtccatc
gcctacggcatcgcgcaagccatgcaccgtgaaggggctgaactggcgttcacctatcag
aacgaaaaactgaaaggtcgtgtggaagaatttgccgccgcgctgggctctaatatcgtc
ctgccgtgcgatgtcgcggaagatgagagcatcgagtctctgttcaccgagctggcaaaa
gtgtggccgaagttcgacggtttcgttcactctatcggctttgcgccggcagaccagctg
gacggcgactacgttaacgcggtcactcgtgaaggtttcaaaatcgctcacgatatcagc
gcctacagctttgtggcgatggcgaaagcctgccgcggtatgctgaacccgggctccgcc
ctgctgacgctctcctacctgggcgcagagcgcgccatcccgaactacaacgtgatgggt
ctggcgaaagcctctcttgaagctaacgtgcgctacatggcgaacgccatgggcccggaa
ggcgttcgcgttaacgccatctctgccggtccgatccgtaccctggcggcttccggtatt
aaagatttccgtaagatgctggcgcactgcgaagcggtcaccccgatccgtcgcaccgtc
accactgaagacgtgggcaacagcgcagcattcctgtgctccgacctgtctgccggcatc
tccggcgaagtcgttcacgttgacggcggcttcagcatcgccgccatgaacgagctggaa
ctgaaataa

DBGET integrated database retrieval system