KEGG   Klebsiella michiganensis M1: HR38_22460Help
Entry
HR38_22460        CDS       T03349                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
kom  Klebsiella michiganensis M1
Pathway
kom00500  Starch and sucrose metabolism
kom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HR38_22460
Enzymes [BR:kom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HR38_22460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C Malt_amylase_C UPF0016 DUF1939
Motif
Other DBs
NCBI-ProteinID: AIE71115
UniProt: A0A0J2K3K7
LinkDB All DBs
Position
4787274..4788761
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPTGGELWREVEALAPNLNEIGINMIWLPPAYKGASGGYSVGYDCYD
LFDLGEFDQKGSVATKYGDKTQLLAAISALRQHDIAVLLDVVVNHKMGADEKEPVRIQRV
DQNDRTQIAEEIVECEAWTRYTFPVRAGKYSEFIWDYKCFSGIDHIENPDEDGVFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNRAVTEEIKYWARWVMEQTGCDGFRLDAVKHI
PAWFYKEWIDHVQEVATKPLFIVAEYWSHEVDKLQQYIDMVDGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFSGTLVEADPFHAVTLVTNHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYADLFGASYEDTGDDGETYAVEMPVIEQLHELIDARQRFAHGVQTLWFDHPNCI
AFSRSGTEEDPGCVVVLSNGDDGEKTLPLGENYRNKRWRDFLGNRKEVIETDDEGNGVFT
CNGGSVSVWVIEEVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccacgttactgcagtgctttcactggtactaccccaccggcggcgaatta
tggcgtgaagtcgaagccctggcgccaaacctcaacgaaatcggcattaacatgatttgg
ttgcctcctgcctacaaaggcgcctccggcggctactctgtcggttatgattgctacgat
ctgtttgacctcggcgaattcgaccagaaggggtctgtcgccacgaaatatggcgataaa
acccagctactggccgccatatccgccctgcgccagcacgatatcgccgtactccttgac
gtcgtggtcaaccataaaatgggcgcggatgaaaaagagccagtacgtattcagcgtgtt
gatcaaaacgaccgcacgcaaatcgccgaggagattgtggaatgtgaagcctggacgcgc
tacaccttcccggtacgcgccggcaaatactctgaattcatctgggattataagtgcttc
agcggcatcgaccatattgagaatcctgatgaagatggcgtgtttaaaatcgtcaacgac
tataccggcgaaggatggaacgatcaggttgatgatgaaatgggtaacttcgactacctg
atgggtgaaaatatcgattttcgcaatcgagcggtgacagaggagattaagtactgggcc
cgctgggtgatggaacaaaccggctgcgatggcttccgcctcgatgcggttaaacatatc
cccgcctggttttataaagagtggatcgaccacgtccaggaggtggcgacaaagccgctg
tttattgtggcggaatactggtcgcatgaagtcgataagctccagcagtatatcgacatg
gttgacggtaagacgatgctctttgacgcgccgctgcagatgaaattccatgaagcctcg
cggcaggggcgcgactatgacatgagccagatttttagcggtacgctggtggaagccgac
ccgttccacgccgtaaccctggtgaccaaccatgatacccaaccgctgcaggcgctggag
gcgccggttgaggcctggttcaaaccgctggcttatgcgctcattttgttacgtgaaaac
ggcgttccgtccgtcttttatgccgacctgttcggcgccagctacgaagataccggcgac
gacggcgagacctacgccgttgagatgccggttatcgagcagttacacgaactgatcgat
gcccgtcagcgttttgctcacggcgtacaaacgctgtggttcgatcatccgaactgtatc
gctttcagccgcagcggcaccgaggaggatccgggctgcgtggtggtgctttccaacggt
gacgacggagaaaaaacgcttcctcttggggaaaactaccgtaataaacgctggcgtgat
tttctcggcaaccgcaaggaagtgattgaaaccgacgatgaaggaaacggggtttttacc
tgtaacggcggcagcgtcagcgtctgggttatcgaagaggtgctataa

DBGET integrated database retrieval system