KEGG   Klebsiella michiganensis M1: HR38_23790Help
Entry
HR38_23790        CDS       T03349                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kom  Klebsiella michiganensis M1
Pathway
kom00010  Glycolysis / Gluconeogenesis
kom00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:kom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HR38_23790
   00500 Starch and sucrose metabolism
    HR38_23790
Enzymes [BR:kom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     HR38_23790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038 Albumin_I_a
Motif
Other DBs
NCBI-ProteinID: AIE71357
UniProt: A0A1P7TZQ0
LinkDB All DBs
Position
complement(5069548..5070942)
Genome map
AA seq 464 aa AA seqDB search
MKTFPQAFLWGGATAANQVEGAYLEDGKGLTTSDVQPRGVFGDVVERVPGDSGIKDVAID
FYHRYPEDISLFAEMGFNCLRVSIAWARIFPEGDEAQPNEAGLAFYDKLFDEMAKHNITP
LVTLSHYEMPWALVKNYGGWGNRKVIGFFERYARTVFARYQAKVKLWLTFNEINMSLHAP
MTGVGLPADSSKAEVYQAIHHQLVASALAAKACHDIVPEGKIGNMLLGGLMYPLSCKPDD
IFETLQQNRSWQFFGDVQCRGAYPGYMLRYFRDNGISLEIADADREALKETVDFISFSYY
MTGCVTADEELNKKSRGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKVEADGSINDDYRISYLNDHLVQAREAIEDGVELMGYTSWGPIDLVSASKAE
MSKRYGFIYVDRDDEGNGTLARSRKKSFWWYKEVIATNGGSLKE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattcccacaggcgtttttatggggcggcgcgaccgcggcaaaccaggttgaa
ggcgcttatctggaagacgggaagggattaaccacttctgacgtccagccgcgcggcgta
tttggcgacgtcgtagaacgcgtgcctggcgatagcggtataaaagatgttgctatcgat
ttttaccatcgttatccggaggatatcagcctctttgccgagatgggctttaactgcctg
cgcgtatccattgcctgggcgcgtattttccctgagggcgatgaggcgcagccaaacgaa
gccgggctggccttttacgataagctgtttgatgaaatggcgaagcacaatattactccg
ctggtgaccctgtcccactatgagatgccgtgggcgctggtgaaaaactacggcggctgg
ggcaatcgcaaagtcattggcttcttcgaacgctacgcccgtacggtgtttgcgcgctac
caggcgaaggtcaaactgtggctgacctttaatgaaatcaatatgtccctgcacgcgccg
atgaccggcgtcggtctgccggccgacagcagcaaagctgaagtctaccaggccattcat
catcagctggtggcgagcgcgctggcggctaaggcctgccatgacatcgtgcctgagggc
aaaatcggcaacatgctgctcggcggcctgatgtatccgctgagctgcaaaccggacgat
atttttgaaaccctgcagcagaaccgcagctggcagttctttggcgatgtccagtgccgc
ggcgcttacccgggctatatgctgcgctatttccgcgacaacggcattagccttgagatc
gccgatgccgatcgcgaagccctgaaagagaccgtcgattttatctccttcagctactat
atgaccggctgcgtgaccgccgacgaagagctgaacaaaaaatcgcgcggcaatattctc
agcatggtgccgaacccgcacctggcaagctcggagtggggctggcagattgaccccctc
ggcctgcgcacgctgctgaacgtgctgtgggatcgctatcagaagccgctgtttatcgtt
gaaaacggcctgggcgctaaggataaggtggaagccgacggtagcatcaacgacgattac
cggatcagctaccttaacgaccacctggtgcaggctcgtgaggcaatagaggacggcgtt
gagttgatgggctacaccagctggggacctatcgacctggtgagcgcgtcgaaggcggag
atgtccaaacgctatggctttatctacgtcgatcgcgacgatgaaggcaacggcaccctg
gcgcgcagccgcaagaagagcttctggtggtataaagaggtaatcgccaccaacggcggc
agcttaaaagagtaa

DBGET integrated database retrieval system