KEGG   Kosakonia oryzae: AWR26_02850
Entry
AWR26_02850       CDS       T04433                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kor  Kosakonia oryzae
Pathway
kor00052  Galactose metabolism
kor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AWR26_02850
Enzymes [BR:kor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     AWR26_02850
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C TrkA_N Methyltransf_25 2-Hacid_dh_C UDPG_MGDP_dh_N Pyr_redox_2 Methyltransf_31 Shikimate_DH PrmA ADH_zinc_N_2 CoA_binding MTS Met_10 Methyltransf_11 3HCDH_N Methyltransf_24 ELFV_dehydrog
Other DBs
NCBI-ProteinID: ANI81134
LinkDB
Position
complement(590614..591657)
AA seq 347 aa
MKSVVIHAEGHVCVEERPEPQLQHDDDVKVRVVSSGLCGSDIPRIFAGGAHFYPITLGHE
FSGYVETCGKAINDLHAGDAVACVPLLPCFDCAECRREYFSLCKRYQFVGSRSDGGNAEY
IVVKRANLIALPKEMAIEDGAFIEPITVGLHAFHLAGGCENKNVIIVGAGTIGLLAMQCA
RALGAKSVTAIDINPDKLQLASELGATYTFNSHEQDMSVIAAGLEEARFDQLVLETAGTP
QTVSLAIEIAGPRAQLALIGTLHHDLTLTAPVFGQILRKEMTLIGSWMNYSGPWPGEEWT
TATRLLTEKKLMLEPLIAHRGDPDSYARAVQNLNGAPMQGKILLRLD
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttatccatgctgagggccacgtctgcgttgaagaacgtccggaacct
cagttgcagcacgatgatgatgtcaaagtcagggtagtcagttccggactgtgcggttct
gacatcccgcgtatctttgccggcggtgcgcatttttatccgattaccctgggacatgaa
ttcagcggttatgttgaaacctgcggcaaggcaatcaacgatttacacgccggagatgcg
gtggcatgcgtgccgttgttgccctgctttgattgcgcggagtgccgccgcgagtacttc
tccttgtgcaagcgctaccagtttgtcggctcgcgcagcgacggcggtaatgccgaatac
atcgtggtgaaacgggcgaatctgatcgcgttgccgaaggaaatggcgattgaagatggc
gcatttattgaacctatcaccgtcggcctgcacgctttccaccttgctggcggttgtgaa
aacaaaaatgtgatcattgtcggtgccggtaccattggcctgctggccatgcagtgcgca
cgggcgcttggcgccaaaagcgttaccgctatcgatatcaaccccgacaagctacaactg
gccagcgaactcggcgcaacctacaccttcaatagtcacgagcaggatatgagcgtgatt
gccgcaggcctggaagaggcgcgtttcgaccagttggtgctggaaacagcaggaacgccg
caaaccgtctcactggcaatcgaaatcgccgggccgcgcgcacaactggcattgatcggt
accctgcatcacgacctgacgttaaccgcgcccgtgttcggccaaattctgcgcaaagaa
atgaccctgattggcagttggatgaactactccggcccgtggccgggcgaagagtggaca
acggctacacgcctgctgacagagaaaaagctgatgctggagccgttgatcgcccatcgc
ggtgatccggacagttacgcccgtgcagtacagaaccttaacggtgcgccaatgcagggc
aaaatcctgttacggctcgattaa

DBGET integrated database retrieval system