KEGG   Kosakonia oryzae: AWR26_16520Help
Entry
AWR26_16520       CDS       T04433                                 

Definition
(GenBank) cysteine/glutathione ABC transporter ATP-binding protein/permease CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
kor  Kosakonia oryzae
Pathway
kor02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kor00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AWR26_16520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kor02000]
    AWR26_16520
Transporters [BR:kor02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    AWR26_16520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 SMC_N AAA_16 DUF87 NACHT RsgA_GTPase AAA_22 MMR_HSR1 AAA_29 FtsK_SpoIIIE AAA_30 Mg_chelatase AAA_23 DUF815 SbcCD_C AAA_18 AAA_7 Rad17 Zeta_toxin DUF4337
Motif
Other DBs
NCBI-ProteinID: ANI83684
LinkDB All DBs
Position
3515738..3517459
Genome map
AA seq 573 aa AA seqDB search
MRALLPYLALYKRHKWMLLLGVLLAIVTLLASIGLLTLSGWFLSASAVVGVAGLYSFNYM
LPAAGVRGAAITRTAGRYFERLVSHEATFRVLEHLRVATFSKLLPLSPAGLARFRQGELL
NRVVADVDTLDHLYLRVISPLIGALVVILVVMVGLSVLDVSLALMLGGIMLATLLILPPL
FYRAGKPTGESLTAMRGQYRQQLTSWLQGQAELTIFGASQRYREQLENTELNWHDAQRRQ
SDLSAISQALMLLISGVAVIVMLWFASGDVGGNTQPGALIALFVFCALAAFEALAPVTGA
FQHLGQVIASATRITQITDCPPDVTFPQSSMSVPEHVAVQFKDLAFSYPGQPQRALENIA
LSIAAGEHVAILGRTGCGKSTLLQLLTRAWDPQQGEIRLNDMMLSDVDEATLRSLISMVP
QRVHLFSATLRDNLLLAAPQASDETLSAMLTRVGLEKLLDDGGLNAWLGEGGRQLSGGEL
RRLAIARALLHDAPLVLLDEPTEGLDAETESQVLELLREEMKDKTLLMVTHRLRGLAFFD
RIIVMDNGQIIEQGNHAALMAKQGRYYQFKQRL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctttgttgccctatcttgcgctgtataaacgccacaaatggatgttgctgctg
ggcgtgctcctcgcgattgtcaccctgctggccagtatcgggctgttaacgctctccggg
tggttcctgtcggcctctgcagtcgttggcgtggccgggctttacagttttaactatatg
ctacctgcggccggggttcgtggcgcggctattacccgtaccgccggacgttattttgag
cgtctggtcagtcatgaggccactttccgcgtactggaacatttgcgcgtcgccactttc
agcaaactattacccctctcccctgccgggctggcgcgttttcgccaaggggaattgctg
aaccgggtggtggccgatgtcgatacactcgaccatctttatttgcgcgtcatctctccg
ctgatcggcgcactggtggtcatccttgtggtgatggtcggtttaagcgttctggatgtc
tctctggcactgatgctgggcggcattatgctggctacactgcttatattgccgccactc
ttttaccgggcgggcaaaccaaccggcgagagcctgacagcgatgcgcggccagtatcgt
cagcaattaaccagttggttgcagggccaggcggagctaaccatttttggtgccagccag
cgctaccgtgaacaactggagaacaccgagttaaactggcacgacgcccagcgccgtcag
tctgacctgagtgccatttctcaggcgctgatgttgctgattagcggtgtagcggtcatc
gtcatgctatggtttgcttccggcgatgttggcggcaatacgcagccaggcgcattaatc
gcgctgttcgtcttctgtgcactagcggcctttgaagcgctggcaccggttactggcgct
ttccagcaccttggccaggtgatcgcttccgccacacgcattacgcaaatcaccgactgc
ccgccagatgtgactttcccgcaatccagcatgtctgtaccagagcatgttgccgtgcaa
tttaaggatctggcttttagctatcctgggcagccacagcgtgcgctggagaatatcgca
ttgtcgatagctgcgggtgaacatgtcgccatcctgggccgtaccggctgcggcaaatca
acgctgctacaactgcttacgcgcgcgtgggatccgcagcagggcgaaattcgcctgaac
gatatgatgctgagcgatgtggacgaagcgacgctacgttcgctcatcagcatggttcca
cagcgcgtacatctgtttagcgctacgttgcgtgataacttgctgcttgcagcgccgcag
gcgagtgatgaaacgttgagcgcgatgctgacgcgcgtcgggctggaaaagctgctggat
gatggcggtctgaacgcttggttaggtgaaggtggtcgccagctttccggtggcgaattg
cgccgcctggcaattgcccgcgcgctgttgcatgacgctccgctggtcctactggatgaa
ccaaccgaagggctggacgctgaaacagaaagccaggtgcttgaattacttcgtgaagag
atgaaagacaaaacgctgttaatggtcacgcaccgtctgcgcggtctggcgttttttgat
cgcataattgtgatggacaacggacaaataattgagcaaggtaatcacgcagcgttaatg
gcgaaacagggtcggtattaccagtttaagcagcgtctgtag

DBGET integrated database retrieval system