KEGG   Kosakonia oryzae: AWR26_19995
Entry
AWR26_19995       CDS       T04433                                 

Definition
(GenBank) hypothetical protein
  KO
K03397  indoleacetate---lysine synthetase [EC:6.3.2.20]
Organism
kor  Kosakonia oryzae
Brite
KEGG Orthology (KO) [BR:kor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AWR26_19995
Enzymes [BR:kor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.20  indoleacetate---lysine synthetase
     AWR26_19995
SSDB
Motif
Pfam: AMP-binding Hemopexin
Other DBs
NCBI-ProteinID: ANI84325
LinkDB
Position
complement(4257837..4259045)
AA seq 402 aa
MDYCCAEMYAKMQPRITAITGCQAFDYMAFRDSVRISSHVYSTTGDSGSLTQRDSAAEQI
PMLLGATSGTTGAMKMISVRLKSSKDAVSASEHNLIHNLRSRQVFSAGDVVGNLFTINLF
SSLHYSACEILKHCRAHVVPVGDIALLRKSHFDFLAEIQLSTLFGVPATLVQFVETMIGL
GVPLAIKKVVFTGEPMLAAHENYLREVLGDDLRIIGLYGLSECGFIGMSVEGHHNKYLLF
SDDFFFEYDDKKGLLITSLDPDASRKLIRYPVGDLGKLSVENNQLYFQGIKRNAIDFNFM
GNLISHEKISRMINQRLPEAIVQIVLSLSAERQEIMDIKICCGLSHDVDLSELEDEICHL
PDIYEAYMKKRGRINLTIVEYNALLFSPRGKCLLVCDTRESC
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggattattgctgcgctgagatgtatgcaaaaatgcaaccgcggattacggcaattacc
ggatgccaggcattcgattatatggccttccgtgattcagtcaggattagttcccacgtt
tattcaaccactggcgacagtggttctttgacgcaacgggactctgcggctgaacaaata
ccgatgctgcttggcgccacaagcggcaccaccggggcgatgaaaatgatcagcgtccgt
ttaaaatccagtaaggacgcggtcagcgcatcggaacacaacttaattcataacctgcgg
tcgcggcaggttttttccgccggcgacgtcgttggcaatctttttacgattaacctgttt
tcatccttacactattcggcgtgtgaaattttaaaacattgccgcgcgcatgtggtgccg
gtcggcgatattgcattgctgcggaagagtcatttcgattttctggccgaaatccagctc
tcgacgctgtttggtgtgccggcgactctcgttcagtttgtggaaaccatgatcgggctt
ggggttccgctggccattaaaaaagtggtctttaccggcgaaccgatgttggccgcgcat
gaaaactatctgcgcgaggtgctgggcgacgacctgcggataatcggtttgtacggcctg
tcggagtgcggtttcattgggatgtctgtcgaggggcatcataataagtatctgctgttc
agcgatgatttcttctttgaatatgacgataaaaaggggctattgatcacctcgctggac
ccggatgcctcgcgtaaacttatcagatatccggtaggggatctgggcaaattatccgtt
gaaaataatcaactctattttcagggtattaaacgcaacgctattgattttaatttcatg
ggcaatctgattagccatgaaaaaatatccagaatgattaatcaacgattgcctgaggcg
attgttcaaatcgtcttgtcgttatccgctgagagacaagaaattatggatattaaaatc
tgctgcggattatctcatgacgttgatttgtccgaactggaggatgaaatctgtcatttg
ccggatatttatgaagcctatatgaaaaagcggggacgtatcaacctcaccattgttgag
tataacgctctgcttttttccccccgagggaaatgtctgctggtttgcgacacaagggag
tcatgctaa

DBGET integrated database retrieval system