KEGG   Kosakonia oryzae: AWR26_21395Help
Entry
AWR26_21395       CDS       T04433                                 

Definition
(GenBank) two-component system response regulator
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
kor  Kosakonia oryzae
Pathway
kor02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AWR26_21395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kor02022]
    AWR26_21395
Two-component system [BR:kor02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   AWR26_21395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ANI84585
UniProt: A0A1T5G8K3
LinkDB All DBs
Position
4585248..4585964
Genome map
AA seq 238 aa AA seqDB search
MQTPHILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSENDINLVIMDINLPGK
NGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR
TMNLGTVSEERRSVDSYKFNGWELDINSRSLISPNGEQYKLPRSEFRAMLHFCENPGKIQ
SRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRFCGDLQE
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccccgcacattcttattgttgaagacgagttggtaacacgcaacacgttaaaa
agcattttcgaagcagaaggctacgatgtctttgaagcgactgatggcgctgaaatgcat
cagattctttctgaaaatgatatcaacctggtgattatggatattaacctgccaggtaaa
aacggtcttttgctggcacgcgaacttcgtgagcaggcgaacgtcgcactgatgttcctg
accggacgtgataacgaagtcgataagattttgggcctcgaaattggtgccgacgactac
atcacgaagccgtttaacccacgtgaactgacgatccgcgcacgcaatctgctgtcccgc
accatgaatctgggcacggtcagcgaagaacgccgcagcgttgacagctacaagttcaac
ggttgggagctggatatcaatagccgctcactgatcagcccaaacggcgaacagtataag
ctgccgcgcagtgaattccgcgcgatgctgcacttctgcgaaaatccggggaaaatccag
tcccgtgccgaactgttgaaaaaaatgaccggccgcgagctgaagccgcacgaccgcacc
gtggacgtgacgattcgtcgcattcgcaaacattttgaatccacgccggacacgccggaa
atcatcgccaccattcacggtgaaggttaccgtttctgcggcgatctgcaggaataa

DBGET integrated database retrieval system