KEGG   Kosakonia oryzae: AWR26_23490Help
Entry
AWR26_23490       CDS       T04433                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kor  Kosakonia oryzae
Pathway
kor00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AWR26_23490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kor02000]
    AWR26_23490
Enzymes [BR:kor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AWR26_23490
Transporters [BR:kor02000]
 Other Transporters
  Pores ion channels [TC:1]
   AWR26_23490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ANI84968
LinkDB All DBs
Position
complement(5019919..5020587)
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNQSRSQRILWALEELGVPYQIVRYQREKTMLAPESLKKIHPLGKSPVVEDNGL
IIAESGAILEYLQETYDPEHRFAPQAGKSKQDYRFWLHYAEGSLMPLLLMKLIMTRLSKP
PVPFGVRSVGKLLASGVEKAFLNRQLETHARFIEAELAQHSWFTGNQLSMADIQMSFPVF
ALLARGGVDDLPNLRAWKKRVERRPAWQRAIVQGGPFDFPGG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcttacggtgcatcacctgaatcaatcgcgctcgcagcgcattctctgggctttggag
gagctgggcgtgccgtaccagatcgtccgttatcagcgtgaaaaaaccatgctggcaccc
gaatcactaaaaaaaattcacccgttgggcaaatcgccggtggtggaagataacgggctt
atcatcgctgagtccggcgcgattctcgaatatttgcaggaaacctacgatccggaacac
cggtttgcgccgcaagcgggaaaaagcaaacaggattaccgcttctggctgcattacgcc
gaaggttcgctgatgcccctactattgatgaaactgataatgacacgccttagcaaaccg
cctgtaccgtttggcgtgcgcagcgtcggtaagctgctggcgagcggcgtggagaaagcc
tttctcaaccggcaactggaaacccacgcgcgctttattgaagcggaactggcacaacat
agctggtttaccggcaatcagctcagcatggcggatatacagatgagtttccccgtattc
gcgctgctggcgcgcggcggtgtggatgatcttcccaatttacgggcgtggaaaaagcgg
gtggaaaggcgtccggcctggcagcgggcgattgtccagggtgggccgtttgatttcccc
ggcggctaa

DBGET integrated database retrieval system