KEGG   Kordia sp. SMS9: KORDIASMS9_02202Help
Entry
KORDIASMS9_02202  CDS       T05562                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
kos  Kordia sp. SMS9
Pathway
kos00380  Tryptophan metabolism
kos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kos00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    KORDIASMS9_02202 (kynU)
Enzymes [BR:kos01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     KORDIASMS9_02202 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 SHMT Cys_Met_Meta_PP Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AXG69973
UniProt: A0A345H085
LinkDB All DBs
Position
2457963..2459222
Genome map
AA seq 419 aa AA seqDB search
MFQNTLAFAQAQDAKDPLKSYRTKFHIPKDADGNEWLYFCGNSLGLQPKVTQEYIQQELN
DWANLGVEGHFDAKNPWMPYHEFLTENMAKIVGAKPIEVVIMNTLTTNLHLLMVSFYQPT
KTKYKIVIESDAFPSDRYAVESQLKFHGFDPKEGLLEWTPREGEELLRMEDLETMLEEEG
DEIALLMIGGVNYYTGQYFDIKKIAELGHAKGAMVGIDLAHGAGNIQPNLHDSNVDFAAW
CTYKYLNSGPGSLAGLFVHEKHAHDKELHRFAGWWGHDKETRFNMRYDFNPIPGAESWQL
SNPPILSMAAVKASLDMFNEVGMDALREKSKQLTAYFEYLINEVETDRIKIITPSNPEER
GCQLSIQVKNADKSLHQKLLDKHIISDWREPDVIRCAPVPLYNSYEDVFKMVNELKKCL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaacacactggcgtttgctcaagcgcaagacgcaaaagatcctctaaaaagc
taccgtacaaaatttcacattcccaaagatgctgacggaaatgaatggttgtatttctgt
ggaaattcacttggattgcaacccaaagtaacacaagaatacattcagcaagagctgaac
gattgggcaaatttaggtgtggaaggacattttgatgcaaaaaatccgtggatgccctac
catgaatttctcaccgaaaacatggcgaaaatagtaggagcaaagcccattgaagtcgtg
atcatgaacacgcttacgacaaatctacacttattgatggtttcgttctatcaaccgaca
aaaacaaaatataaaattgtcatcgaaagtgatgcgtttccttctgatcggtatgcggta
gaatcacaattaaaatttcacggattcgatccaaaagaaggattgctcgaatggacgcca
cgcgaaggcgaagaattgctccgtatggaagatttggaaacgatgctagaagaagaaggt
gatgaaattgcattgttgatgattggcggtgtgaattattacaccggacaatattttgat
attaaaaaaatagcggaactcggtcatgccaaaggcgcgatggttggcattgatttggcg
catggtgcaggaaacattcaaccgaatttgcacgattctaatgtagattttgccgcttgg
tgtacgtataaatatttgaattcgggccctggaagtttggcaggattgtttgtgcatgaa
aagcatgcacatgataaggaactccatcgttttgcaggttggtggggacacgataaggaa
acgcgttttaatatgcgttatgactttaatccgattcctggtgcggaaagttggcaattg
agcaatccgcccatattgtcaatggcagcagtgaaagcgtctcttgatatgttcaatgaa
gttggaatggacgctttgcgcgaaaaatctaaacaattaacagcctattttgaatactta
atcaatgaggttgaaaccgatcgcatcaaaataattacaccttccaaccctgaagaaaga
ggttgccaattgtcgattcaagtcaaaaatgcagacaaatcattacaccaaaaattgttg
gacaaacacatcatttccgattggcgcgaacccgacgtaattcgctgtgcgccagtgccg
ttatacaactcttatgaagatgtattcaaaatggtgaacgaacttaaaaaatgcttgtaa

DBGET integrated database retrieval system