KEGG   Kordia sp. SMS9: KORDIASMS9_03451Help
Entry
KORDIASMS9_03451  CDS       T05562                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kos  Kordia sp. SMS9
Pathway
kos00620  Pyruvate metabolism
kos00680  Methane metabolism
kos01100  Metabolic pathways
kos01120  Microbial metabolism in diverse environments
kos01200  Carbon metabolism
Module
kos_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KORDIASMS9_03451 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    KORDIASMS9_03451 (ppc)
Enzymes [BR:kos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     KORDIASMS9_03451 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 LuxQ-periplasm
Motif
Other DBs
NCBI-ProteinID: AXG71195
UniProt: A0A345H3Q7
LinkDB All DBs
Position
3949826..3952414
Genome map
AA seq 862 aa AA seqDB search
MSRKPKLKRFNENVSSKYQIYNSIFMTLPFDEISNTGALLPLFSDTCEQGYDLDRNPSQI
VEKFFERYVNHNKTKDEKNNLLFRFIQYIERQVVLFDAVEDAAFSIVNNMEGRGTLRNIK
EEAEEKHKLDALKTYLKRFKVRPVLTAHPTQFYPGQVLGIITDLAEAIKVDDLLTIKKLL
AQLGKTPFFKKEKPTPYNEAVSLIWYLQNVFYHSASKIYSYIKENIFEGEEMDNQVIDLG
FWPGGDRDGNPFVTTDITLKVAERLRNTILVNYYRDIRDLKRRITFKGVEQRLVNLEHML
YNNVYLRKEEGMLSLAEFETELKGIRAVIISDHQSLFVAELDDLINKVKLFGYHFAMLDI
RQDSRVHQGVFENIVETMKDRGEALFSIDYINASEEEKINVLTQIDATVEAKYFENEITN
ATISSIYAMKTIQARNGERGSNRYIISNNQSALHVMEAFTMLRLCDWKQPDVDVSPLFET
VPDLQAAEGVMRTLYTNEAYAAHLKRRGNKQYIMLGFSDGTKDGGYLMANWSIFKAKEEL
TAISREYGIKVIFFDGRGGPPARGGGKTHQFYASLGNTVEDEEIQLTIQGQTISSNFGTL
ESSQYNLEQLLSSGISNEIFSGAKAEFSEDDKKTMETLASVSYDAYVAFKKHPRFLTYLE
RMSTLKYYAKTNIGSRPSKRSQSKEFNFSDLRAIPFVGSWSQLKQNVPGFYGVGTALEHM
EKNGQFEAVEKLYKNSSFFRTLLANSMMSLTKSFFKLTAYMKDNEEFGEFWTVIFEEFNR
TKRMLLKLTGYETLMENELAGKASIHAREKIVLPLLTIQQYALRRIHELQKDPNADENEI
KTYEKMVTRSLFGNINASRNSA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtaaacccaaattgaaacgttttaatgaaaatgtttcttctaaataccaaatc
tacaacagtatttttatgaccttgccttttgacgagatctcaaatacgggtgctttattg
cccttatttagtgatacttgcgagcaaggatacgatttagacagaaatccatcacaaatt
gttgaaaagttctttgagcgatatgtgaatcacaacaaaacaaaagacgaaaaaaacaat
ctactctttcgtttcattcaatatattgagcgccaagtcgtactatttgatgccgtagaa
gatgccgcattttccatagtaaataatatggaaggtcgtggtacgcttcgaaacatcaag
gaagaagcagaggaaaaacacaagctagacgcgctaaaaacctatttaaagcgtttcaaa
gtccgtccggtattaacagcacatccaacgcaattctatccagggcaagtgctaggaatc
attacggatttggcagaagctatcaaagtagatgatttattgaccatcaagaagcttttg
gcgcaattaggaaaaacaccgttcttcaaaaaagaaaaaccaacgccgtacaacgaagcg
gtaagcttaatctggtatttgcaaaatgtgttctatcattcggcaagtaaaatttacagt
tacatcaaagaaaacatatttgaaggggaagaaatggacaatcaagtcattgatttaggg
ttttggcctggtggcgatcgtgatggaaatccgtttgtaactacagatatcacactcaaa
gtcgcagaacgtttgcgaaatacgattttagtgaactattaccgcgatatacgagattta
aagcgtagaataacgtttaaaggtgttgaacaacgtttggtgaatttagaacacatgttg
tacaacaatgtgtatctgcgaaaagaagaaggcatgttgtcattggctgaatttgaaaca
gaactaaaaggcatcagagcggttattatttcagatcatcaatcgctttttgtggcagaa
ttggatgatttaatcaacaaagtaaaactatttgggtatcactttgcgatgttagacatt
cgtcaagattcgagagtgcatcaaggtgtatttgaaaatattgtagaaaccatgaaagat
cgcggagaagctttattttcaatagattatataaatgcttcggaagaagaaaaaatcaac
gtcttaacacaaattgatgcaaccgtagaagcaaaatattttgaaaacgaaattaccaac
gcaacaatttcgtctatatatgcgatgaaaaccatccaagcgcgaaatggagaacgcggt
tccaatcgttatatcatcagtaacaatcaatcggcattgcacgtaatggaagcctttaca
atgttgcgcttatgcgattggaaacaacccgatgtagatgtttctccgttatttgaaacg
gttcccgatttacaagcggcagaaggcgtgatgcgaaccttgtataccaacgaagcgtat
gcagcacatttgaaacgcagaggaaacaaacaatacattatgcttggtttctctgacgga
accaaagatggcggttatttaatggcaaattggagtatttttaaagcaaaagaagaactc
accgcaatttctcgcgaatacggaatcaaagtcatattttttgacggtagaggtggaccg
ccagcgcgtggaggtggaaaaacacatcaattctatgcttctttaggaaatacggtggaa
gatgaagaaattcaattaacaatccaaggacagacgattagctctaactttggaacttta
gaatcgtctcaatacaacttagagcaattgttaagttcaggaatctcaaatgaaatattt
tcaggcgcaaaggcagaattttcagaagatgataaaaagacaatggaaaccttggcttcc
gtaagttatgatgcgtatgtggcatttaaaaaacatccaagattcttaacgtatttagag
cgaatgagtacgttaaaatactatgcaaaaactaacattggaagtcgtccatcgaaacga
tcgcagtctaaagagttcaatttctctgacttacgtgccattccttttgtgggaagctgg
agtcagttgaaacaaaacgttccaggattttacggcgttggaactgcgttagaacacatg
gagaaaaacggtcaatttgaagccgtagaaaaactctacaaaaactcttctttcttccgc
acattgcttgccaacagtatgatgagcttaacgaagtcgttctttaagttaacggcatat
atgaaagataatgaggagtttggtgaattttggacggttatttttgaagaattcaatcgt
acaaaacgaatgcttttaaaactaacgggttacgaaaccttaatggaaaatgaattggca
gggaaagcttcaattcacgcacgtgaaaagattgtgttaccgttacttacgattcaacaa
tacgcattgcgaagaattcacgaattgcaaaaagatccaaatgcagatgaaaacgaaatc
aaaacctatgaaaaaatggtgacacgttcgttatttggaaacataaatgcgagtcgtaat
tcggcgtag

DBGET integrated database retrieval system