KEGG   Kosakonia sp. CCTCC M2018092: EH164_01370Help
Entry
EH164_01370       CDS       T05734                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kot  Kosakonia sp. CCTCC M2018092
Pathway
kot00250  Alanine, aspartate and glutamate metabolism
kot00410  beta-Alanine metabolism
kot00640  Propanoate metabolism
kot00650  Butanoate metabolism
kot01100  Metabolic pathways
kot01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EH164_01370
   00650 Butanoate metabolism
    EH164_01370
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EH164_01370
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EH164_01370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kot01007]
    EH164_01370
Enzymes [BR:kot01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EH164_01370
Amino acid related enzymes [BR:kot01007]
 Aminotransferase (transaminase)
  Class III
   EH164_01370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AZI85797
LinkDB All DBs
Position
299996..301261
Genome map
AA seq 421 aa AA seqDB search
MKNSELHQRRVDATPRGVGVMCGFYAEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VMAAVEKQLQAFTHTAYQIVPYESYIALAERINARVPIDGPAKTAFFSTGAEAVENAVKI
ARAYTKRPGIIAFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAHYPNELHGISTE
QALQSLTHLFKADIAPDQVAAILLEPVQGEGGFNIAPPEFMQALRTLCDSHGILLIIDEV
QSGFARTGKLFASEHYAIKPDLITMAKSLAGGLPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEKLCERANQLGKDLVEVLTHAKARCPHIADIRAQGSMVAVEFQN
PQTGAPSPEFTKQVQDKALQAGLLLLSCGVYGNVIRFLYPLTIPDEQFRKALDIIQRSLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatagtgaattacatcagcggcgtgtagacgcgacgccgcgcggggttggcgtg
atgtgcggcttctacgccgagaaagcagaaaacgccacgctgtgggatgtggaaggcaac
gaggtgattgattttgccgccgggatcgcggtgttaaacaccggtcatcgacatccgaaa
gtaatggcggcagtcgaaaaacagctccaggccttcacgcacaccgcgtatcaaattgtt
ccttacgaaagctatatcgcgcttgccgagcgcatcaacgcgcgcgtccccattgatggc
ccggcgaaaaccgccttcttctctaccggtgccgaagcggttgaaaacgcggtgaaaatc
gcccgcgcttacactaaacgtccgggcattatcgcctttggcggcggcttccacggacgc
acctttatgaccatggcgctgacgggaaaagttgcgccttacaaaatcggcttcgggccg
tttcccggttcggtttatcacgcccactatccaaatgagctgcacggcatcagcactgaa
caggcgctgcaaagcctgacgcatctcttcaaagccgatatcgcccccgatcaggttgcc
gcgatcctgttagagccggtgcagggcgaagggggctttaatatcgctccgccagagttt
atgcaggcgctgcgtacgctgtgcgacagccacggcattctgctgatcattgacgaggtg
cagagcggttttgcccgtaccggcaaactctttgccagcgagcattacgccatcaaaccc
gatctcatcactatggcgaaaagcctggcgggtggtttaccgctctcggcggtcgccggg
cgtgccgaggtaatggatgcccctgcgcctggcggcctgggcggaacctatgccggtaat
ccgctggcggtggcggcagcgcatgcggtgcttgatgtgattgaagaggagaagctgtgt
gaacgcgcgaaccagctgggcaaagatctggtcgaagtgctgacccatgcgaaagcgcgc
tgcccgcatattgccgatatccgtgcacagggctcgatggtggcggtcgaatttcagaac
ccgcaaaccggtgcgccatcaccggaatttactaaacaggtgcaggataaagcgcttcag
gccgggttgctgctgctgagctgcggcgtctatggcaacgttatccgcttcctctatccg
ctgaccattcctgatgagcagttccgaaaagcgctggatattatccagcggtcgctgacg
cgttaa

DBGET integrated database retrieval system