KEGG   Kosakonia sp. CCTCC M2018092: EH164_02685
Entry
EH164_02685       CDS       T05734                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kot  Kosakonia sp. CCTCC M2018092
Pathway
kot00052  Galactose metabolism
kot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    EH164_02685
Enzymes [BR:kot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     EH164_02685
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C TrkA_N Methyltransf_25 2-Hacid_dh_C MTS Methyltransf_24 Methyltransf_11 UDPG_MGDP_dh_N Pyr_redox_2 CoA_binding ADH_zinc_N_2 Methyltransf_31 3HCDH_N ThiF Shikimate_DH PrmA Pyr_redox Met_10 ELFV_dehydrog Methyltransf_12
Other DBs
NCBI-ProteinID: AZI86039
UniProt: A0A3G9BM51
LinkDB
Position
complement(549923..550966)
AA seq 347 aa
MKSVVIHAEGNVCVEDRPEPQLQHEDEVKVRVVSSGLCGSDIPRIFANGAHFYPITLGHE
FSGYVEACGPAVTDLHAGDAVACVPLLPCFDCPACRREYYSLCKRYQFIGSRCDGGNAEY
IVVKRPNLVRLPVDLPIEDGAFIEPITVGLHAFHLAEGCKDKNVVIVGAGTIGLLAMQCA
RALGAKSVTAIDINPDKLALATALGATRTFNSREQSAADILAGLEAESFDQLVLETAGTP
QTVSLAIEIAGPRAQVALVGTLHDELTLTATVFGLILRKELTLIGSWMNYSGPWPGEEWH
TAARLLTEKRLALEPLIAHRGGPESYARAVQALNGKPMQGKILLRLD
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcatgctgagggcaacgtctgcgttgaagatcgccctgaaccc
cagttgcagcatgaggatgaggtgaaggtgagagtagtcagctccggcctgtgcggctcg
gatattccgcgcatcttcgctaacggcgcgcatttttaccctattacccttgggcatgag
ttcagcggttatgtcgaagcctgcggcccggcggttaccgatctgcacgctggcgacgcc
gtggcctgcgtaccgttgctgccctgctttgactgccctgcctgccgccgtgagtactac
tcgctgtgcaaacgctaccagtttatcgggtcgcgctgcgacggcggcaatgccgaatac
attgtggttaagcgccccaacctggttcgcttacctgtggatctgcccattgaagatggg
gcgtttattgaaccgataaccgttggcctgcacgcatttcacctcgccgagggctgcaaa
gataaaaacgtggtgatcgtcggggctggcactatcgggctgctggcaatgcagtgcgca
cgagccttaggggcgaaaagcgtcaccgccattgatatcaaccctgacaaattagcgctg
gccactgcacttggtgccacccgcacctttaacagccgcgagcagagcgcggctgacatc
ctcgccgggctggaagcagagagcttcgaccagcttgtgctggaaacggctggcacacca
caaacggtctcgctggctatcgaaatcgccggaccgcgtgcgcaggtggcgctggtaggg
acgctgcatgacgaactcacgcttactgctacggtatttgggctgattttgcgtaaagag
ctgacgcttatcggcagttggatgaactactccggcccctggcctggggaggagtggcat
accgcggcgcgtttgctgacggaaaaacgcctcgcccttgagccgctgatcgcccatcgc
ggtggccccgaaagctacgcgcgcgcggtgcaggcgctgaatggcaaaccaatgcaggga
aaaatcctgctgcgccttgattaa

DBGET integrated database retrieval system