KEGG   Kosakonia sp. CCTCC M2018092: EH164_03545Help
Entry
EH164_03545       CDS       T05734                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
kot  Kosakonia sp. CCTCC M2018092
Pathway
kot00030  Pentose phosphate pathway
kot01100  Metabolic pathways
kot01110  Biosynthesis of secondary metabolites
kot01120  Microbial metabolism in diverse environments
kot01130  Biosynthesis of antibiotics
kot01200  Carbon metabolism
kot01230  Biosynthesis of amino acids
Module
kot_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kot_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:kot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EH164_03545 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    EH164_03545 (tkt)
Enzymes [BR:kot01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     EH164_03545 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AZI86199
UniProt: A0A3G9BMJ8
LinkDB All DBs
Position
762407..764398
Genome map
AA seq 663 aa AA seqDB search
MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLNHNPTNPAWADRDRF
VLSNGHGSMLIYSLLHLTGYDLPITELQNFRQLHSKTPGHPEVGYTAGVETTTGPLGQGI
ANAVGMAIAEKTLAAQFNRPGHDIVDHFTYAFMGDGCMMEGISHEACSLAGTLKLGKLVA
FYDDNGISIDGHVEGWFTDDTAKRFEAYGWHVVRGVDGHDADAIKRAVEEARSVTDKPSL
LMCKTIIGFGSPNKAGTHDSHGAPLGDAEVALTREQLGWKHAPFEIPSEIYAQWDAKEVG
QAKESAWNEKFAAYAKAFPELAAEFTRRMKGEMPEDFAAKANEFIAKLQANPAKIASRKA
SQNAIEAFGPLLPEFLGGSADLAPSNLTLWSGSKAINEDAAGNYIHYGVREFGMTAIANG
ISLHGGFVPYTSTFLMFVEYARNAVRMAALMKQRQVLVYTHDSIGLGEDGPTHQPVEQVA
SLRLTPNVSTWRPCDQVESAVAWKYGVERHDGPTALILSRQNLAQQDRTEQQLADIARGG
YVLKDCDGQPQLIFIATGSEVELAVAAWERLTAEGVKARVVSMPSTDTFDKQDAAYRESV
LPKAVSARVAVEAGIADFWCKYTGLNGAVVGMTTFGESAPAELLFEEFGFTVDNVVAKAK
ELL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcacgtaaagagcttgccaatgctattcgtgcgctgagcatggacgcggtacag
aaagccaaatccggtcacccgggagccccaatgggcatggcagacatcgccgaagtgtta
tggcgtgatttcctgaaccataacccgacgaatcctgcatgggctgaccgcgaccgcttt
gtgctgtccaacggtcacggctcgatgctgatctatagcctgctgcacctcaccggctac
gatctgccgattaccgaactgcagaacttccgccagctgcactccaaaactccgggtcac
ccggaagtgggttacaccgctggcgttgaaaccaccaccggcccgctggggcaggggatt
gcaaacgcagtcggtatggcgattgccgagaagacgctggccgcgcagttcaaccgtccg
ggtcatgacattgttgaccacttcacctacgcctttatgggcgacggctgcatgatggaa
ggcatctcccacgaagcctgctcgctggccggtacgctgaagctgggtaaactggttgcg
ttctatgacgacaacggcatctctatcgatggccacgttgaaggctggttcaccgacgat
accgcgaaacgctttgaagcctacggctggcacgttgttcgcggcgtagacggccacgac
gccgatgccatcaaacgcgctgttgaagaagcacgcagcgtcaccgacaaaccgtcgctg
ctgatgtgcaaaaccattatcggtttcggctcgccgaacaaagccggtacccacgactcc
cacggcgcgccgctgggtgacgcggaagtggcactgacccgcgaacagctgggctggaaa
cacgctccgtttgagatcccgtctgagatttatgcgcagtgggatgcgaaagaagtgggt
caggcgaaagagtctgcgtggaacgagaagttcgccgcttacgcgaaagcgttcccggag
ctggctgccgagttcactcgtcgtatgaaaggcgagatgccggaagatttcgcggcgaaa
gccaacgaattcattgccaaactgcaggcgaacccggcgaaaatcgccagccgtaaagct
tcccaaaacgctatcgaagcgtttggcccgctgctgccggagttccttggtggttccgct
gacctcgcgccttccaacctgaccctgtggtccggctcgaaagcgatcaatgaagatgcc
gcaggtaactacattcactacggcgtgcgcgagttcggtatgaccgcgattgccaacggt
atctctctgcatggcggtttcgtgccgtacacctccaccttcctgatgttcgtcgagtat
gcgcgtaacgcggtacgtatggcggcgctgatgaagcagcgtcaggtgctggtttacacc
cacgactctattggtctgggtgaagatggcccgacgcaccagccggttgagcaggttgct
tctctgcgcctgaccccgaacgtcagcacctggcgtccgtgtgaccaggttgagtctgcg
gttgcgtggaaatatggcgttgagcgtcacgacggcccgacggcgctgatcctctctcgc
cagaacctggcgcagcaggatcgtaccgagcagcagctggcggatatcgctcgcggcggt
tacgtgctgaaagattgtgacggtcagccgcagctgatcttcatcgccactggttctgaa
gtggagctggccgttgctgcgtgggaacgtctgacagctgaaggcgtgaaagcgcgcgtg
gtctccatgccgtctaccgacaccttcgacaagcaggatgctgcttaccgtgaatcggtg
ctgccgaaagcggtcagcgcacgcgtggcggtggaagccggtatcgccgacttctggtgc
aaatacaccggcctgaacggcgcggttgttggcatgaccaccttcggtgagtctgcgcca
gcagagctgctgttcgaagagtttggcttcaccgtggataacgtggtcgccaaagcgaaa
gagctgctgtaa

DBGET integrated database retrieval system