KEGG   Kosakonia sp. CCTCC M2018092: EH164_06905Help
Entry
EH164_06905       CDS       T05734                                 

Gene name
fadJ
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
kot  Kosakonia sp. CCTCC M2018092
Pathway
kot00071  Fatty acid degradation
kot00280  Valine, leucine and isoleucine degradation
kot00281  Geraniol degradation
kot00310  Lysine degradation
kot00362  Benzoate degradation
kot00380  Tryptophan metabolism
kot00410  beta-Alanine metabolism
kot00640  Propanoate metabolism
kot00650  Butanoate metabolism
kot00903  Limonene and pinene degradation
kot00930  Caprolactam degradation
kot01100  Metabolic pathways
kot01110  Biosynthesis of secondary metabolites
kot01120  Microbial metabolism in diverse environments
kot01130  Biosynthesis of antibiotics
kot01200  Carbon metabolism
kot01212  Fatty acid metabolism
Module
kot_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EH164_06905 (fadJ)
   00650 Butanoate metabolism
    EH164_06905 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EH164_06905 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EH164_06905 (fadJ)
   00310 Lysine degradation
    EH164_06905 (fadJ)
   00380 Tryptophan metabolism
    EH164_06905 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EH164_06905 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EH164_06905 (fadJ)
   00281 Geraniol degradation
    EH164_06905 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EH164_06905 (fadJ)
   00930 Caprolactam degradation
    EH164_06905 (fadJ)
Enzymes [BR:kot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EH164_06905 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EH164_06905 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EH164_06905 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DUF448
Motif
Other DBs
NCBI-ProteinID: AZI86799
UniProt: A0A3G9BP55
LinkDB All DBs
Position
1459445..1461592
Genome map
AA seq 715 aa AA seqDB search
MMTVSAFTLTVRPDNVAVVTIDVPNEKMNTLKAEFGAQVRAILKEIRDNRALRGVVFISA
KADNFIAGADINMIGRCQSAKEAEELALQGQKIMAEIHALSIPVVAAIHGACLGGGLELA
LACHRRVCSDDGKTILGLPEVQLGLLPGSGGTQRLPRLVGVSTALEMILTGKQLRARQAL
KVGLVDDVVPHDILLETAVELAQQERPLSRRLPVRERILAGPLGRTLLFKMAAKRTEQKT
HGNYPAAPRILSVIETGLAQGRSSGYEAEARAFGQLAMTPQSQALRNIFFASTDIKKDPG
STVAAAPLHTVGILGGGLMGGGIAYVTASKGRLPVRIKDINAKGINHALKYSWQELDRKV
RRRFIKPGERDSQMAKISGSLDYLGFAHRDVVIEAVFEDLSLKQKMVSEVEAHCAPHTIF
ASNTSSLPIADIAENAARPGKVIGLHFFSPVEKMPLVEVIPHAGTDEQTIATTVKLAKKQ
GKTPIVVADKAGFYVNRILAPYISEAMRMLSEGEPIEAIDRALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPATLVSAILNDDRKGRKNGRGFYLYPTKGRKSKKQPDAS
IYRLIGVSAKGHSSAQQIAERCVLLMLNEAARCFDEQVIRSARDGDIGAVFGIGFPPFLG
GPFHYMDTLGAASVVASLQQMEARYGARFAPCEALLRMAQEGKRFWPTAESEPVS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
ataatgacggtttctgcatttacccttactgtgcgccccgacaatgtcgcggtcgttacc
atcgatgtacccaatgaaaagatgaacaccctgaaagcggagtttggcgcacaggtgcgc
gccatcttaaaagagatccgtgataaccgcgctctgcgcggcgtggtgtttatttcggcg
aaggcagacaactttattgccggtgccgatatcaatatgattggccgctgccagagcgcg
aaagaagcggaagagctggccctgcaggggcagaagatcatggcggagatccacgctctg
tcgatcccggttgttgccgccatccacggtgcctgtcttggcggcgggctggagctggcg
ctggcctgtcatcgccgcgtctgctcggacgatggcaaaaccattctcggcctgccggaa
gtgcagctcggcttgctgcccggctccggcggcacccagcgtttgccacggcttgtcggt
gtcagcactgcgcttgagatgatcctgaccggcaaacagcttcgtgcgcggcaggcgctg
aaggtggggctggtggatgatgtggtgccgcacgatattctgctggaaaccgcagtcgaa
ctggcgcagcaggagcgccccctcagccgccgtttgccggtacgcgagcgcattctcgcc
ggtccgctcggccgcacgctgctgtttaagatggcggcgaagcgcaccgaacagaaaacc
cacggtaactatcctgccgcaccacgaattttatcggtgattgagaccggtctggcgcag
gggcgcagcagcggctatgaagcggaagcgcgcgcctttggtcaactggcgatgacgccg
cagtcgcaggcactgcgtaatatcttctttgcttcaaccgacatcaaaaaagatcctggc
agcacggttgctgccgcgccgctgcataccgtcggtattctcggcggcggattgatgggc
ggcggcattgcgtatgtcaccgccagcaagggccgtttgccggttcgcattaaagatatc
aatgcgaaaggcattaaccacgcgctgaagtacagctggcaggaattagatagaaaagtg
cgtcgccgctttatcaaacccggcgagcgcgacagccagatggcgaagatctccggctcg
cttgattacctcggttttgctcatcgcgatgtggtaatcgaagcggtgtttgaagatctc
tccctcaaacagaagatggtgagtgaagtggaggcgcactgcgcgccgcataccattttt
gcctctaacacctcgtcgctgccgattgcggatattgccgaaaatgcggcgcgtcccggc
aaggtgatcggattacattttttcagcccggtggagaagatgccgctggtggaagttatt
ccgcacgccggtaccgatgagcagactatcgccaccaccgtgaagctggcgaagaagcag
ggcaaaacgccgattgtcgttgcagataaagcgggcttttacgttaaccgtattctcgca
ccctatatcagtgaagcgatgcgcatgctgagcgagggcgagccgattgaggccatcgac
cgggcgctggtgaagtttggtttcccggtaggcccgattcagctactggatgaagtgggc
atcgataccggaacgaagatcattcctgtgcttgaggccgcttacggggagcgttttagc
gcgcctgcaacgcttgtctccgcgattttgaatgacgatcgcaaagggagaaaaaatggt
cgtggtttctatctttacccgacaaaagggcgtaaaagcaaaaaacagcccgacgcctcg
atctaccgcttaatcggcgtgtcggcgaaagggcactcctcggcgcagcagattgccgag
cgctgtgtcctgctgatgcttaacgaagcggcgcgctgttttgatgagcaggtgatccgt
agcgcgcgcgacggcgatatcggtgccgttttcggcattggcttcccaccatttttaggg
gggcctttccactatatggatacgctgggcgcggcaagcgtcgtggcgtcgctgcagcag
atggaggcgcgttatggggcacgatttgcaccgtgtgaagccctgttacgcatggctcag
gaggggaaacgcttctggccgacagcggaaagtgagcctgtaagttaa

DBGET integrated database retrieval system