KEGG   Kosakonia sp. CCTCC M2018092: EH164_08275Help
Entry
EH164_08275       CDS       T05734                                 

Gene name
dacD
Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase DacD
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
kot  Kosakonia sp. CCTCC M2018092
Pathway
kot00550  Peptidoglycan biosynthesis
kot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kot00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EH164_08275 (dacD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kot01002]
    EH164_08275 (dacD)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kot01011]
    EH164_08275 (dacD)
Enzymes [BR:kot01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EH164_08275 (dacD)
Peptidases and inhibitors [BR:kot01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   EH164_08275 (dacD)
Peptidoglycan biosynthesis and degradation proteins [BR:kot01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   EH164_08275 (dacD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AZI87049
UniProt: A0A3G9BPW3
LinkDB All DBs
Position
1768466..1769626
Genome map
AA seq 386 aa AA seqDB search
MKRRLFAASLLAVSVHCAQADDLPFAPQPPAVQAGSWVLMDYTTGQILTAGHEHQQRNPA
SLTKLMTGYVVDRAIDSHRISADDVVTVGKDAWAQGNPVFAGSSLMFLKPGDRLTVRDLS
RGLIVDSGNDACVALADHVAGGQPQFVAMMNDYVQKLNLRDTHFETVHGLDAPGQHSSAY
DLAVLSRAIIHGEPDFYHMYSEKSLTWNGITQQNRNGLLWDKSLNVDGLKTGHTSGAGFN
LIASSVDGQRRLIAVIMGADSPKGREEQARKLLHWGQQNFDTVEILRNGKKVGSERVWYG
DKEQIAVGTNEDRWLVLPKAELQNIKAKYVLDSKELEAPLAAHQRVGEIQLYDRDKVIAK
MPLVTLESVGKGGLFSRLSDYLHHKG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgccgtttgtttgctgcttcattgttggcggtgagcgtccattgcgctcaggcc
gacgacctcccatttgcccctcagcccccggcagtacaggccggatcatgggtattgatg
gactacaccaccgggcaaatcttaactgcggggcatgagcatcagcagcgtaatccggcg
agtctcaccaaattgatgaccggctatgtcgtcgatcgtgccattgatagccatcgcatc
agtgcggacgacgtggttacagtcggcaaagatgcctgggcgcagggcaacccggtgttt
gccggctcgtcactgatgttccttaagccgggcgatcgcctgacggtgcgcgacctgagc
cgtgggctgattgtcgattccgggaatgacgcctgcgtggcactggcggatcacgtcgcc
ggcgggcagccgcagttcgtggcgatgatgaacgactatgtgcagaaactgaatctgcgt
gatacccacttcgaaacggtacacggcctggatgcgccggggcagcacagttcggcctac
gatcttgcggtgttatcgcgcgccattattcacggcgagccggacttctatcacatgtac
agcgaaaagagcctgacgtggaacggcatcacccagcagaaccgcaacgggctgctgtgg
gataaaagcctgaatgtcgatgggctgaagacaggccacacctccggcgcgggctttaac
ctgattgcctcaagcgttgatggtcaacgccgtttgatcgccgtgatcatgggcgcagac
agcccgaaagggcgcgaagagcaggcgcgcaagctgctgcactggggtcagcagaacttc
gatacggttgagatcctgcgtaacggcaaaaaagtgggcagcgagcgtgtctggtatggc
gataaagagcagattgctgtcggcaccaatgaggaccgctggctggtgctgccgaaagcg
gagctgcaaaacatcaaagccaaatatgtgctggacagtaaagagctggaagcgccgctt
gccgcccatcagcgcgtgggtgaaatccagctttatgaccgcgataaggtgattgccaaa
atgccgctggtgacgctggagagcgtcggcaaaggcgggctcttctcccgactgagtgac
tatctgcaccataaagggtga

DBGET integrated database retrieval system