KEGG   Kosakonia sp. CCTCC M2018092: EH164_13575
Entry
EH164_13575       CDS       T05734                                 

Gene name
phoQ
Definition
(GenBank) two-component system sensor histidine kinase PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
kot  Kosakonia sp. CCTCC M2018092
Pathway
kot01503  Cationic antimicrobial peptide (CAMP) resistance
kot02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kot00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EH164_13575 (phoQ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    EH164_13575 (phoQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kot01001]
    EH164_13575 (phoQ)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kot02022]
    EH164_13575 (phoQ)
   01504 Antimicrobial resistance genes [BR:kot01504]
    EH164_13575 (phoQ)
Enzymes [BR:kot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     EH164_13575 (phoQ)
Protein kinases [BR:kot01001]
 Histidine kinases
  OmpR family
   EH164_13575 (phoQ)
Two-component system [BR:kot02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   EH164_13575 (phoQ)
Antimicrobial resistance genes [BR:kot01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    EH164_13575 (phoQ)
SSDB
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HAMP HATPase_c_2 HisKA HATPase_c_3 HAUS-augmin3 Exonuc_VII_L
Other DBs
NCBI-ProteinID: AZI88028
UniProt: A0A3G9BMT9
LinkDB
Position
2836790..2838250
AA seq 486 aa
MKRLLRHLFPLSLRVRFLLATAAVVMVLSLAYGVVALVGYSVSFDKTTFRLLRGESNLFY
TLAQWKENKLEIDLPENLDLQSPTMTFIYDKNGKLIWSQRNVPWLQKRIEPEWLKSDGFH
EIEADIDSTSTLINDDHAASEQLKAIREDDSDSEMTHSVAVNLYPATARMPQLTIVVVDT
IPIELKRSYMVWNWFIYVLSANLLLVIPLLWLAAWWSLRPIEDLAREVRELEEHHREQLN
PETTRELTSLVQNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVLQSTLRSLRSDKMSV
SEAEPVMLEQISRISQQIGYYLHRATMRGSSMLSRELHPVAALLDNLTSALNKVYQRKGV
NITLDISPEVGFVGEQNDFMEVMGNVLDNACKYCLEFVEVSVNQSDDMLHIVVEDDGPGI
PLAKRELVFDRGQRADTLRPGQGVGLSVAREIVEQYGGQILTGDSLLGGARMEVIFGRQQ
TGITGD
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaaacgcctgctgcggcacctcttcccgctctcgctgcgggtgcgctttttactcgcc
accgccgcggtggtgatggtgctgtcgctggcctatggcgtggtcgcgctggtcggttac
agcgtcagcttcgataaaaccaccttccggctgctgcgcggcgagagcaacctcttctat
acgctggcgcagtggaaagagaacaagctggagattgacctgccggaaaacctcgacctg
caaagcccgaccatgacctttatctacgacaaaaacggcaagctgatctggtcccagcgg
aatgtaccgtggttgcaaaagcgcattgagccggagtggctgaagagcgatggttttcac
gaaattgaagcggatattgactccaccagcacgctgatcaacgacgatcacgccgcttcg
gagcaactcaaagcgatccgcgaagatgacagcgactccgaaatgacccactcggtggcg
gtaaacctctaccctgccaccgcgcgtatgccgcagttgaccatcgtagtagtcgatacc
atcccgatcgagcttaaacgctcctatatggtgtggaactggtttatctatgtgctctcg
gccaacctgctgctggtgatcccgctgctgtggctggcggcctggtggagcctgcggccg
attgaggatctggcgcgcgaggtgcgcgaactggaggagcaccaccgcgaacagcttaac
ccggaaaccacccgcgagttgaccagcctggtgcagaacctcaaccgcttgctgaaaagc
gagcgcgagcgctatgacaaatatcgcaccaccttgaccgatctcacccacagcctgaaa
acgccgctggcggtgctgcaaagcacgttgcgctcgctgcgcagcgacaagatgagcgtc
agcgaggccgaaccggtaatgcttgagcagatcagccgcatctcgcagcaaattggctac
tacctgcaccgcgccaccatgcgcggcagcagcatgctcagccgcgagctgcatccggtc
gctgcgctgcttgataacctcacttccgcgctgaataaggtctatcagcgtaaaggggtg
aatatcacgctcgatatctcgccggaggtcggttttgtcggcgagcagaatgactttatg
gaagtgatgggcaacgtgctggataacgcctgcaaatattgcctggagtttgttgaggtc
tctgttaaccagagcgatgacatgctgcacattgttgtcgaggatgatggtcccggcatt
ccgctggcgaaacgcgaactggtgttcgatcgcggtcagcgcgccgacacgctgcgtccg
ggccagggcgtcgggctttcggtggcgcgggagatcgtcgagcagtatggcgggcagatc
ctcaccggcgacagcctgctcggcggcgcgcgcatggaagtgatttttggtcgtcagcaa
acgggaataacgggcgactga

DBGET integrated database retrieval system