KEGG   Kosakonia sp. CCTCC M2018092: EH164_18560Help
Entry
EH164_18560       CDS       T05734                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kot  Kosakonia sp. CCTCC M2018092
Pathway
kot00473  D-Alanine metabolism
kot00550  Peptidoglycan biosynthesis
kot01100  Metabolic pathways
kot01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EH164_18560
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EH164_18560
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EH164_18560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kot01011]
    EH164_18560
Enzymes [BR:kot01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EH164_18560
Peptidoglycan biosynthesis and degradation proteins [BR:kot01011]
 Precursor biosynthesis
  Amino acid ligase
   EH164_18560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 ATP-grasp TTL ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AZI88926
UniProt: A0A3G9BY64
LinkDB All DBs
Position
complement(3908894..3909814)
Genome map
AA seq 306 aa AA seqDB search
MAEKVAVLLGGTSAERDVSLNSGAAVLAGLREGGVDAHAIDPREVDVTRLKEMGFSKAFI
ALHGRGGEDGTLQGLLELTGVPYTGSGVMASAISMDKLRSKLLWQGAGLPVAPWVALTRS
EFESGLQVSDIQSIEALGLPLIVKPSREGSSVGMSKVNESSDLQAALALAFQHDDEVLIE
KWLSGPEFTVALLGNENLPSIRIQPAGIFYDYEAKYLSDETQYFCPSGLEAEREAALQAL
IAKAWQVLGCRGWGRIDAMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGLSFTQLVVR
ILELAE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagaaagttgccgttctgctgggtggcacctccgccgagcgcgatgtgtcgctt
aattcaggcgcggctgtgcttgccgggctgcgtgaaggtggtgttgacgcccatgccatc
gatccgcgcgaggttgatgtaacccgcctgaaagagatgggcttcagtaaagcgtttatc
gccctgcatggccgcggcggtgaagatggcacgttgcagggtctgctggagctgaccggc
gttccttacaccggcagcggggtgatggcctctgcgatttcaatggataaactgcgcagc
aaactgctgtggcagggcgcgggtttaccagtcgcgccgtgggttgcgctgacgcgcagc
gagtttgaatcaggcctgcaagtgtctgatattcaaagtattgaagcgttgggcttaccc
ctgatcgttaagccaagccgtgaaggctcaagcgtcgggatgtcaaaggtcaacgaaagt
agcgatctgcaggcggctttagcgcttgcttttcaacacgatgatgaagttctgatcgaa
aaatggctcagtggcccggaatttaccgtcgcgttgcttggaaatgaaaatttaccgtcg
attcgcattcaaccggcgggaatcttctatgattatgaggcgaagtatctctctgatgag
acgcagtatttctgcccatcaggtctggaagcagagcgggaagcggctttacaggcgctg
atcgccaaagcgtggcaggttttaggctgccgcggctgggggcgaattgatgccatgctc
gacagcgatggtcaattttacttgctggaagcgaatacctcgccgggtatgaccagccat
agcctggtgccgatggcggcgcgtcaggcggggctgagctttacccagcttgttgttcgt
attctggaactggcggagtga

DBGET integrated database retrieval system