KEGG   Klebsiella michiganensis KCTC 1686: KOX_03520Help
Entry
KOX_03520         CDS       T01681                                 

Definition
(GenBank) PTS system galactitol-specific transporter subunit IIA
  KO
K02773  galactitol PTS system EIIA component [EC:2.7.1.200]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00052  Galactose metabolism
kox01100  Metabolic pathways
kox02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:kox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KOX_03520
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    KOX_03520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kox02000]
    KOX_03520
Enzymes [BR:kox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.200  protein-Npi-phosphohistidine---galactitol phosphotransferase
     KOX_03520
Transporters [BR:kox02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Galactitol-specific II component
    KOX_03520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2
Motif
Other DBs
NCBI-ProteinID: AEX02443
UniProt: A0A0H3H227
LinkDB All DBs
Position
742252..742719
Genome map
AA seq 155 aa AA seqDB search
MSQLFVRTGIHFSSSRQALEHIGEEMLARGVVHDSYPLALLEREATFPTGIALEQHAVAI
PHCEAVHAKSPAIYLIRPDNPVPFQRADDDGEIDVSLIIALIVENPTAQLQLLRRLFSEL
QNPNTLEALLAASQEQLPELFRHSILESEPSAQAL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaattgtttgttcgtaccggcattcattttagttccagccggcaggcgctggag
cacattggcgaagagatgctggcgcgcggcgttgtgcacgacagctatccactggcgctg
ctcgaacgagaagcaactttccccacaggcattgcgctggagcagcacgcggtcgcgatt
ccccactgcgaggcggtacatgcgaagtctccggctatctacctgattcgcccggacaac
ccggtcccttttcagcgagctgacgacgacggcgaaatcgacgtttcgttaatcatcgcg
ctgattgtagaaaatccgactgcacagctacagctgctgcgccggttatttagtgagcta
cagaacccgaacacgcttgaagcattgctggctgcctcacaggagcagctgcccgagctg
tttcggcactctatccttgagtcagagcccagcgctcaggctttataa

DBGET integrated database retrieval system