KEGG   Klebsiella michiganensis KCTC 1686: KOX_03535
Entry
KOX_03535         CDS       T01681                                 

Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00052  Galactose metabolism
kox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KOX_03535
Enzymes [BR:kox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     KOX_03535
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 TrkA_N MTS Methyltransf_31 UDPG_MGDP_dh_N PrmA CoA_binding ELFV_dehydrog 3HCDH_N Methyltransf_11 Shikimate_DH Pyr_redox_2
Other DBs
NCBI-ProteinID: AEX02446
UniProt: A0A0H3GZ05
LinkDB
Position
744455..745498
AA seq 347 aa
MQSVVIHAEGTVRVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGSAVTDLQPGDAVACVPLLPCFNCPQCQREYFSLCKQYQFVGSRSEGGNAQY
VVVKRANLFRLPDQMPIDDGAFIEPMTVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGAKSITAIDINPQKLALAKTLGATHVFNSKEMSGKQIQTALEEIQFDQLVLETAGTP
QTVALGIEVAGPRAQLALVGTLHHDLTLPFATFGQILRKELTIVGSWMNYSGPWPGKEWQ
TAVRLLTEKRIQLAPLITHIGDAESFAREVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgcaatcagtggttatccatgctgaggggacagtgcgcgttgaagaacgcccgataccg
actctacaaacggaaaacgatgtcctggtcaaagtcgtcagctccggattgtgcggttcc
gatattccgcgcatcttcgccaaaggcgcccactactatcccatcaccctgggtcatgag
ttcagcggctatgttgaatcttacggctcagcggtgaccgacctgcagccgggcgacgcg
gtagcctgcgtgcctctgctcccctgctttaactgcccccagtgccagcgcgaatacttc
tctctctgcaaacagtaccagtttgtcggttcgcgcagcgaaggcggaaatgcgcagtac
gtggtggtcaaacgcgccaacctgttccgtctgccggaccagatgccgattgatgacggc
gcgtttattgaaccgatgaccgtcggcctgcacgccttccatctggctcagggctgcgaa
gggaaaaacgtcattattattggcgcaggcacaatcggtttgctggcgttgcagtgcgcc
cgcgaactgggcgccaaaagcattacggcaatcgatatcaacccgcagaagctggcgctg
gcaaaaacgctcggcgcaacgcacgtctttaacagcaaggagatgagcggcaaacagatt
caaacggcgctggaagagattcagttcgaccagctggtgctggaaaccgccggtacgccg
caaaccgtggcgctgggcattgaggtcgccggaccgcgcgcgcagctggcgctggtgggt
accttgcaccatgacttaacgctgcctttcgccacctttggccagattcttcgaaaagag
ctgactattgtcggcagctggatgaactactcgggcccgtggcctggaaaagagtggcaa
acggcggttcgcctgctgacggaaaaacgcattcagcttgccccgcttatcacccacatc
ggcgatgccgaaagctttgcccgcgaagtccaggcgctcaacggtgcgccgatgcagggg
aaaatcctgcttaaactctcctga

DBGET integrated database retrieval system