KEGG   Klebsiella michiganensis KCTC 1686: KOX_13540
Entry
KOX_13540         CDS       T01681                                 

Definition
(GenBank) PTS system mannose-specific transporter subunit IIC
  KO
K11196  fructose PTS system EIIC component
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00051  Fructose and mannose metabolism
kox02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:kox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KOX_13540
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    KOX_13540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kox02000]
    KOX_13540
Transporters [BR:kox02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    KOX_13540
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: AEX04432
UniProt: A0A0H3HA79
LinkDB
Position
2929097..2929897
AA seq 266 aa
MTTIQIILLLVIAAITGMGSVLDEGQTHRPLVACTLVGWVLGDMTTGIILGGTLEMMALG
WMNVGLAMAPDTAIASVISTILVINTNQGIGEGIAIAVALAAAGQALTIFVRTMTVFLIH
RADTYAEKGNMRGIEIMHITALGFQALRVMIPTFVVVMMSVDSVQAMLNGIPPVVTHGLQ
IGGGIIVVVGYAMVINMMSVKYLMPFFFAGFLIAAFTSFNLVGLGGMGLVGALLYIQLSP
KYQPKTLTAVADGGPASLNNNDDLDA
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaccactatacaaattatattgctgctggtgattgcagccattaccgggatgggtagc
gtgctggatgaagggcaaacgcatcgtccacttgttgcctgtacgctggttggctgggta
cttggcgatatgactaccggtatcattcttggcggtacgctggaaatgatggccctcggg
tggatgaacgttgggctggcgatggcgccggataccgccatcgcctcggtgatatcgacc
attctggtgattaatacaaatcaggggattggcgaaggcatcgcgattgccgtcgcgtta
gccgctgcgggtcaggcgctgacgatttttgtcagaacgatgacggtgttcttgatccac
cgggcggatacctatgctgaaaagggcaatatgcgcggtatcgaaatcatgcatatcact
gcgcttggtttccaggcgctgcgcgtgatgattcctacctttgtggtggtcatgatgagc
gttgattcggtgcaggccatgttgaacggtattccgccagtggtgacgcatggtctgcaa
attggcggcggtattattgttgttgtgggttatgccatggtcatcaatatgatgagcgtc
aaatatcttatgccgttcttttttgccggtttcttgattgcggcttttaccagtttcaac
cttgttggtttagggggaatgggattagtcggtgcgttgctgtatatacagctgagtcca
aaataccagcctaaaaccctgaccgccgtggcggatggtgggccggcttctttaaataat
aacgacgatttggatgcataa

DBGET integrated database retrieval system