KEGG   Klebsiella michiganensis KCTC 1686: KOX_26170Help
Entry
KOX_26170         CDS       T01681                                 

Gene name
glpA
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00564  Glycerophospholipid metabolism
kox01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kox00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KOX_26170 (glpA)
Enzymes [BR:kox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KOX_26170 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_oxidored FAD_binding_3 DAO_C Pyr_redox_2 Thi4 3HCDH_N GMC_oxred_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AEX06943
UniProt: A0A0H3HHG4
LinkDB All DBs
Position
5656328..5657950
Genome map
AA seq 540 aa AA seqDB search
MADSREYDVIIIGGGATGAGIARDCALRGLKAALVERYDIATGATGRNHGLLHSGARYAV
TDSESARECISENRILRRIARHCIEPTSGLFITLPEDDPAYQHTFITACQQAGIEAQPLT
PAEALRIEPAVNPALLGAVQVPDGTVDPFRLTAANMLDAREHGAAILTGCEVTGLLRQGD
RVHGVTIYNHQLRESRTLRAQVVVNAAGIWGQRIAEYADLRIAMFPAKGSLLILDHRINR
QVINRCRKPADADILVPGDTISLIGTTSMHIPYDEIDDNRVTAEEVETLLREGEKLAPIM
GRTRVLRAYSGIRPLVASDDDPSGRSVSRGIVLLDHARRDGLEGFITITGGKLMTYRLMA
EWATDALCRKLGNTVPCTTADTPLPGSQEPAEATLRKIISLPASLRGSAIYRHGDRTPAW
LGDSRQHRSLVCECEAVTAGEVQYAVENLAVKNLLDLRRRTRVGMGTCQGELCACRAAGL
LARFNVTTSARSLTQLSQFLNERWKGVQPVAWGDALRESEFTRWVYLGLCGLQKEHQDEV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggccgatagtcgtgaatatgacgtcattattattggcggcggcgccaccggcgccggg
atcgcgcgcgactgcgcgctgcgcgggctgaaggcggcgctggttgagcgctacgatatc
gccaccggggcgaccggccgcaaccacggcctgctgcacagcggcgcgcgctatgcggta
accgatagcgaatcggcgcgggagtgtatcagcgaaaaccgcatcttacgccgcatcgcc
cggcactgcattgagcccaccagcggcctgtttattaccttgccggaagacgatccggcg
tatcagcacacctttatcaccgcctgccagcaggcgggtattgaggcccagcctctgacg
cccgccgaggcgctgcgcattgagcctgcggttaacccggcgctgctcggcgcggtgcag
gtccccgacggcaccgtcgatcctttccgcctcaccgccgcaaatatgctcgatgcccgc
gaacatggcgccgctatcctcaccggctgcgaagtcaccggcctgctgcgtcagggcgat
cgcgtccatggcgtcacgatctacaaccatcagctccgtgaatcgcgcacgctgcgcgcg
caggtggtggtcaacgccgccgggatctgggggcagcgcatcgcagagtatgccgacctg
cgcatcgcgatgtttccggcaaaaggatcgctgttaatcctcgaccatcgcattaaccgt
caggttatcaaccgctgccgcaaaccggctgacgccgatatcctggtgcccggcgatact
atttcgctgattggcactacttcgatgcatattccctatgacgaaattgacgacaaccgg
gtaacggccgaggaggtcgaaacgctgctgcgcgaaggggaaaagctggcgccgatcatg
gggcggacgcgggtactgcgcgcctactccggcatacgtccgctggtcgccagcgatgac
gatcccagcgggcgcagcgtcagtcgcggtattgtgctgctcgaccacgcccggcgcgac
ggactggagggctttatcaccatcaccggcggtaagctgatgacctatcgtctgatggcg
gagtgggccacggatgcgctctgccgcaagctcggaaataccgtcccctgtacgaccgcc
gatacgccgctgccgggctcgcaggagccggcggaagccacgctacgcaaaatcatctct
ttacctgcgtcgctgcgcgggtcggccatctatcgccacggcgatcgcaccccggcctgg
cttggcgatagccgccagcaccgcagcctggtctgcgaatgcgaggcggtgaccgccggc
gaggttcagtacgcggtcgaaaacctggcggtgaaaaacctgctcgacctgcgccgccgc
acccgcgtcggcatgggaacctgtcagggcgaactgtgcgcctgccgcgccgccgggctg
ctcgcgcgttttaacgtcaccacttccgcacgatcccttacccagctgtctcaatttttg
aacgaacgctggaaaggcgtccagccggtggcctggggggacgcgctgcgcgaaagcgag
ttcacccgctgggtctatctcggcctgtgcggattacaaaaggagcatcaggatgaagtt
tga

DBGET integrated database retrieval system